Entry information : PstrDyPrx04 (DyP4)
Entry ID 9883
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: PstrDyPrx04 (DyP4)
Name (synonym) PstrDyPrx04 (DyP4)
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Punctularia
Organism Punctularia strigosozonata    [TaxId: 202698 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PstrDyPrx04
start..stop
S start..stop
HanDyPrx01 425 1e-145 18..494 9..482
ShirDyPrx02 424 5e-145 8..494 2..486
TvDyPrx01 394 2e-133 18..494 8..483
PoDyPrx04_PC15 393 5e-133 18..494 8..489
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 861194..861276 83 N° 2 861332..861566 235 N° 3 861623..861728 106 N° 4 861755..861914 160
N° 5 861965..862176 212 N° 6 862229..862503 275 N° 7 862563..862973 411  
join(861194..861276,861332..861566,861623..861728,861755..861914,861965..862176, 862229..862503,862563..862973)


exon

Literature and cross-references PstrDyPrx04 (DyP4)
DNA ref. JGI genome:   scaffold_9 (861194..862973)
Protein sequence: PstrDyPrx04 (DyP4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   494
PWM (Da):   %s   54372.64  
PI (pH):   %s   7.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSQVSFQSQQTAPVSSGLDLNNIQGDVIIGLPKKVEECIFLDITDVDCFRKCLKQIAPLITSTSQVQADLASIAASKKKAAAEGHPPPLLPIVGTNISFSHWGLQLGANDDFHDTAFTNGQFKDAKDNWATRRTPRVILIDALILITGERWSTVDHRRAEIFDIFKIGHGHACAKVVFTDKCQVRPGAEKGHEHFGFQDGISQVNSWISKSYDLFLTSTIACHRRRRKTVPGGNLIAPGNVLFGEPVGQTSKPQNAGLTPDWADGSFLVFRHFQQLVPEFNQFLNVHAINDPGLTQEQGAELLGARFFGRWKDGTPTDLSPTHPDPALAKDPQRNNNFDFSDVKDQSKCPFAAHRKTNPRSDLPPNSFDNRRIIRQSITFGPELTPEEIRDSKTHHKRGLAFVCYQASIVDAFQFLQQSWAGNPNFPPGKNVSIGLDPIIGQNGNNSRNMFGSDPLNPGTDLTLPFDFVVPKGGEYFFAPSISALKETLAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). Possible uncorrect splicing prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCAAGTATCTTTCCAATCGCAGCAAACCGCGCCGGTATCATCCGGTCTTGACCTGAACAATATCCAGGGCGATGTCATGTACGTCTATCTGACCGGCTTTCGTCTCAAACCATTC
AAAGGAACGGCGATACAGAATTGGCCTGCCCAAGAAAGTTGAGGAATGCATCTTCCTTGACATCACAGATGTCGATTGTTTCCGGAAATGCTTGAAGCAGATCGCGCCTCTGATCACCAG
CACGAGTCAAGTCCAAGCCGACCTTGCGAGTATCGCAGCCAGCAAGAAGAAGGCAGCCGCTGAAGGACATCCGCCTCCTCTGCTACCCATCGTCGGCACCAACATCTCCTTCTCCCACTG
GGGCCTTCAGAAG
GTACGCAATCCCCGATATTTCTAGCTGATGTGGTCATTCATTTGAGCTGTGACCAGCTCGGTGCCAATGACGACTTCCATGATACCGCATTCACGAACGGCCAGTTC
AAGGACGCCAAGGATAATTGGGCGACCCGACGGACGCCCAGGGTAATCCTGATTG
GTTCGCGGTGTTCAAGCAGAAAATAGACGCCCTGATTCTGATCACTGGCGAGCGTTGGTCTACCG
TCGACCATCGTCGTGCGGAAATCTTCGATATATTCAAGATCGGCCATGGACACGCATGCGCTAAAGTTGTATTCACCGACAAGTGTCAGGTTCGTCCTGGTGCAGAGAAGGGCCATGAGC
A
GTAAGAGCCCGACGTCGCTTGCCGGAGTAACACGCTGACAATGCACATAGCTTCGGTTTCCAGGATGGTATCAGCCAGGTAAACAGCTGGATTTCCAAGTCGTACGACTTGTTTCTTAC
TAGTACAATAGCCTGCCATCGACGGCGTCGAAAAACCGTCCCCGGCGGCAACCTCATCGCCCCGGGAAATGTTCTGTTTGGCGAGCCCGTTGGTCAAACCTCCAAGCCCCAGAACGCGGG
CCTGACGCCGGACTGGGCTAAGG
GTGCGTAAAGACCAGTAAAACAGCATTTTTCCATCTCTCATCTTCCCTGCAGACGGCTCGTTCCTCGTCTTCCGCCACTTCCAGCAGCTCGTGCCGG
AATTCAACCAATTCCTCAATGTCCACGCGATCAACGACCCCGGTCTCACGCAGGAGCAGGGCGCGGAGCTCCTCGGTGCTCGCTTCTTCGGCAGGTGGAAGGACGGCACGCCGACCGACC
TTTCTCCCACCCACCCAGACCCTGCGTTAGCGAAGGACCCGCAGAGGAACAACAACTTCGATTTCTCTGATGTCAAGGACCAGAGCAAGTGCCCTTTCGCAGCGCACGTC
GTACGTCGTA
TTTGTCAAATCGGTCACCAGTCTGCGCTGACTGTAACGTCACTAAACAGCGCAAGACCAACCCTCGCAGCGACCTGCCTCCCAACTCATTCGACAACAGACGCATCATCCGCCAAAGCAT
CACCTTCGGGCCGGAGCTCACCCCCGAGGAGATCAGAGACTCGAAGACGCACCACAAGCGCGGCCTTGCCTTCGTCTGCTACCAGGCGAGCATCGTCGACGCTTTCCAGTTCTTGCAGCA
GTCCTGGGCGGGCAACCCCAACTTCCCGCCGGGGAAGAACGTGAGCATCGGCCTCGATCCCATCATTGGTCAGAATGGGAACAACAGCCGGAATATGTTCGGCTCGGACCCTCTCAATCC
GGGTACGGACCTTACGCTTCCCTTCGATTTTGTAGTCCCGAAGGGAGGCGAGTATTTCTTCGCGCCGAGCATCAGTGCTCTCAAGGAAACCCTAGCGCTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCAAGTATCTTTCCAATCGCAGCAAACCGCGCCGGTATCATCCGGTCTTGACCTGAACAATATCCAGGGCGATGTCATAATTGGCCTGCCCAAGAAAGTTGAGGAATGCATCTTC
CTTGACATCACAGATGTCGATTGTTTCCGGAAATGCTTGAAGCAGATCGCGCCTCTGATCACCAGCACGAGTCAAGTCCAAGCCGACCTTGCGAGTATCGCAGCCAGCAAGAAGAAGGCA
GCCGCTGAAGGACATCCGCCTCCTCTGCTACCCATCGTCGGCACCAACATCTCCTTCTCCCACTGGGGCCTTCAGAAG
CTCGGTGCCAATGACGACTTCCATGATACCGCATTCACGAAC
GGCCAGTTCAAGGACGCCAAGGATAATTGGGCGACCCGACGGACGCCCAGGGTAATCCTGATTG
ACGCCCTGATTCTGATCACTGGCGAGCGTTGGTCTACCGTCGACCATCGTCGTGCG
GAAATCTTCGATATATTCAAGATCGGCCATGGACACGCATGCGCTAAAGTTGTATTCACCGACAAGTGTCAGGTTCGTCCTGGTGCAGAGAAGGGCCATGAGCA
CTTCGGTTTCCAGGAT
GGTATCAGCCAGGTAAACAGCTGGATTTCCAAGTCGTACGACTTGTTTCTTACTAGTACAATAGCCTGCCATCGACGGCGTCGAAAAACCGTCCCCGGCGGCAACCTCATCGCCCCGGGA
AATGTTCTGTTTGGCGAGCCCGTTGGTCAAACCTCCAAGCCCCAGAACGCGGGCCTGACGCCGGACTGGGCTAAGG
ACGGCTCGTTCCTCGTCTTCCGCCACTTCCAGCAGCTCGTGCCG
GAATTCAACCAATTCCTCAATGTCCACGCGATCAACGACCCCGGTCTCACGCAGGAGCAGGGCGCGGAGCTCCTCGGTGCTCGCTTCTTCGGCAGGTGGAAGGACGGCACGCCGACCGAC
CTTTCTCCCACCCACCCAGACCCTGCGTTAGCGAAGGACCCGCAGAGGAACAACAACTTCGATTTCTCTGATGTCAAGGACCAGAGCAAGTGCCCTTTCGCAGCGCACGTC
CGCAAGACC
AACCCTCGCAGCGACCTGCCTCCCAACTCATTCGACAACAGACGCATCATCCGCCAAAGCATCACCTTCGGGCCGGAGCTCACCCCCGAGGAGATCAGAGACTCGAAGACGCACCACAAG
CGCGGCCTTGCCTTCGTCTGCTACCAGGCGAGCATCGTCGACGCTTTCCAGTTCTTGCAGCAGTCCTGGGCGGGCAACCCCAACTTCCCGCCGGGGAAGAACGTGAGCATCGGCCTCGAT
CCCATCATTGGTCAGAATGGGAACAACAGCCGGAATATGTTCGGCTCGGACCCTCTCAATCCGGGTACGGACCTTACGCTTCCCTTCGATTTTGTAGTCCCGAAGGGAGGCGAGTATTTC
TTCGCGCCGAGCATCAGTGCTCTCAAGGAAACCCTAGCGCTC

Retrieve as FASTA