Entry information : PoDyPrx04_PC15
Entry ID 9884
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PoDyPrx04_PC15
Name PoDyPrx04_PC15
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoDyPrx04_PC15
start..stop
S start..stop
HanDyPrx01 526 0 1..491 1..484
GmarDyPrx02 518 0 8..488 29..498
GmarDyPrx03 512 1e-179 8..488 27..500
CcinDyPrx01 507 1e-177 3..484 12..486
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2526302..2526354 53 N° 2 2526023..2526242 220 N° 3 2525666..2525964 299 N° 4 2525313..2525611 299
N° 5 2525195..2525255 61 N° 6 2525004..2525138 135 N° 7 2524804..2524946 143 N° 8 2524443..2524744 302
complement(join(2524443..2524744,2524804..2524946,2525004..2525138,2525195..2525 255,2525313..2525611,2525666..2525964,2526023..2526242,2526302..2526354))


exon

Literature and cross-references PoDyPrx04_PC15
DNA ref. JGI genome:   scaffold_11 (2526354..2524443)
Protein sequence: PoDyPrx04_PC15
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   504
PWM (Da):   %s   54778.98  
PI (pH):   %s   6.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTPAPPLDLNNIQGDILGGLPKRTETYFFFDVTNVDQFKANMAHFIPHIKTSAGIIKDREAIKEHKRQKKPGLVPMAAVNVSFSHLGLQLGITDDLSDNAFTTGQRKDAEILGDPGSKNGDAFTPAWEAPFLKDIHGVIFVAGDCHGSVNKKLDEIKHIFGVGTSHASISEVTHVRGDVRPGDVHAHEHFGFLDGISNPAVEQFDQNPLPGQDPIRPGFILAKENGDSRAAARPDWAKDGSFLTFRYLFQMVPEFDDFLESNPIVLPGLSRKEGSELLGARIVGRWKGAPIEITPLKDDPKLAADAQRNNKFDFGDSLVRGDQTKCPFAAHIRKTYPRNDLEGPPLKADIDNRRIIRRGIQFGPEVTSQEHHDKKTHHGRGLLFVCYSSSIDDGFHFIQSWANAPNFPVNAVTSAGPIPPLDGVVPGFDAIIGQKVGGGIRQISGTNPNDPTTNITLPDQDFVVPRGGEYFFSPSITALKTKFAIGVASPAPHSQAPIS

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACACCTGCACCACCCCTCGACCTCAACAACATTCAAGGTGATATCCTGTACGTCTTGTCCTCCTCCAGGATCGTATTTGCAGTTCCTGACTGCATGCATATTGCAGCGGCGGAT
TGCCGAAGAGGACCGAGACCTACTTCTTCTTCGATGTCACCAACGTCGACCAATTCAAGGCCAACATGGCCCATTTCATTCCTCACATAAAGACGTCTGCAGGAATCATCAAGGACCGCG
AAGCGATCAAGGAGCACAAACGTCAGAAGAAGCCAGGCTTGGTCCCCATGGCCGCTGTCAACGTTTCCTTCTCTCATCTCGGTCTTCAGAAG
GTATGCAAACTATTTCCCGTCACCGTTT
ATGAAATCAATCATTAATATCTCGCCTTAGCTTGGGATCACGGATGACCTGAGCGATAATGCCTTTACGACTGGTCAGCGCAAGGATGCTGAAATTCTTGGTGATCCTGGTAGTAAGAAT
GGTGACGCTTTCACCCCAGCATGGGAGGCCCCCTTCCTCAAGGATATCCACGGTGTCATCTTTGTTGCTGGAGATTGCCATGGATCAGTGAACAAGAAACTCGACGAGATCAAGCACATC
TTCGGTGTCGGCACCTCCCATGCTTCAATCTCCGAGGTAACCCACGTTCGCGGAGATGTCCGTCCGGGCGATGTCCACGCCCATGAACA
GTGTGTCTTTGTGTTATTTACATACTCCTCG
ACTTATTGCTGACATTTCCTCAGCTTCGGCTTCCTCGACGGTATCTCCAACCCTGCTGTCGAGCAATTCGACCAGAACCCGCTCCCAGGTCAAGATCCGATCAGACCGGGGTTCATCCTA
GCGAAGGAAAATGGAGATAGTCGCGCCGCTGCCAGACCCGATTGGGCTAAAGATGGAAGTTTCTTAACCTTCAGATATCTGTTCCAGATGGTCCCTGAGTTTGACGACTTCCTCGAAAGC
AACCCCATTGTTCTACCTGGTTTATCGAGGAAGGAAGGTAGCGAGCTCCTTGGTGCAAGGATTGTAGGCCGATGGAAGAGTG
GTATGCACATTATTATTTTTGTTTCGACTTCACCACTA
ACCACTGCGCTCTCAATAGGTGCGCCCATTGAGATAACTCCCCTTAAAGACGACCCGAAGCTGGCGGCCGACGCTCAAAGGTGAACTTCTGCCACTGTGCTGCGGGAGAACGCATTTGAC
TGAAACCCCGCACTAGGAACAACAAGTTCGACTTTGGTGATTCCTTAGTTCGAGGCGATCAGACGAAGTGCCCTTTTGCTGCTCACATCCGAAAGACATACCCCCGCAACGATTTGGAGG
GCCCCCCTTTGAAAGCTGATATTGACAACCG
GTACCCTGTGCTTGTCTTACCGAAAGAAAACACTTCCTGACCACTCCGTGTTCATAGTCGAATCATCCGCCGCGGCATTCAATTCGGTC
CTGAGGTCACAAGCCAGGAGCACCACGACAAGAAGACGCACCACGGACGTGGCCTTCTATTTGTCTGCTACTCCAGCAGTATCGATGATGGCTTCCACTTCATTCAGGAAT
GTACGTCCT
CCCTATTCACCACACCTTTACCACCCTATTCACTGGCGGCTTGTTTTTAGCTTGGGCCAATGCCCCGAACTTCCCAGTTAATGCTGTGACTTCGGCTGGCCCCATTCCACCATTGGATGG
AGTCGTTCCTGGTTTCGATGCTATCATCGGACAGAAGGTCGGTGGAGGTATCAGGCAGATTAGTGGTACCAACCCCAACGATCCCACTACGAACATCACGCTTCCGGACCAAGACTTCGT
TGTCCCAAGGGGTGGAGAGTATTTCTTCTCGCCGTCCATCACGGCTTTGAAGACTAAGTTCGCTATTGGCGTTGCCTCTCCTGCTCCTCACTCCCAAGCTCCAATCTCTGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACACCTGCACCACCCCTCGACCTCAACAACATTCAAGGTGATATCCTCGGCGGATTGCCGAAGAGGACCGAGACCTACTTCTTCTTCGATGTCACCAACGTCGACCAATTCAAG
GCCAACATGGCCCATTTCATTCCTCACATAAAGACGTCTGCAGGAATCATCAAGGACCGCGAAGCGATCAAGGAGCACAAACGTCAGAAGAAGCCAGGCTTGGTCCCCATGGCCGCTGTC
AACGTTTCCTTCTCTCATCTCGGTCTTCAGAAG
CTTGGGATCACGGATGACCTGAGCGATAATGCCTTTACGACTGGTCAGCGCAAGGATGCTGAAATTCTTGGTGATCCTGGTAGTAAG
AATGGTGACGCTTTCACCCCAGCATGGGAGGCCCCCTTCCTCAAGGATATCCACGGTGTCATCTTTGTTGCTGGAGATTGCCATGGATCAGTGAACAAGAAACTCGACGAGATCAAGCAC
ATCTTCGGTGTCGGCACCTCCCATGCTTCAATCTCCGAGGTAACCCACGTTCGCGGAGATGTCCGTCCGGGCGATGTCCACGCCCATGAACA
CTTCGGCTTCCTCGACGGTATCTCCAAC
CCTGCTGTCGAGCAATTCGACCAGAACCCGCTCCCAGGTCAAGATCCGATCAGACCGGGGTTCATCCTAGCGAAGGAAAATGGAGATAGTCGCGCCGCTGCCAGACCCGATTGGGCTAAA
GATGGAAGTTTCTTAACCTTCAGATATCTGTTCCAGATGGTCCCTGAGTTTGACGACTTCCTCGAAAGCAACCCCATTGTTCTACCTGGTTTATCGAGGAAGGAAGGTAGCGAGCTCCTT
GGTGCAAGGATTGTAGGCCGATGGAAGAGTG
GTGCGCCCATTGAGATAACTCCCCTTAAAGACGACCCGAAGCTGGCGGCCGACGCTCAAAGGAACAACAAGTTCGACTTTGGTGATTCC
TTAGTTCGAGGCGATCAGACGAAGTGCCCTTTTGCTGCTCACATCCGAAAGACATACCCCCGCAACGATTTGGAGGGCCCCCCTTTGAAAGCTGATATTGACAACCG
TCGAATCATCCGC
CGCGGCATTCAATTCGGTCCTGAGGTCACAAGCCAGGAGCACCACGACAAGAAGACGCACCACGGACGTGGCCTTCTATTTGTCTGCTACTCCAGCAGTATCGATGATGGCTTCCACTTC
ATTCAGGAAT
CTTGGGCCAATGCCCCGAACTTCCCAGTTAATGCTGTGACTTCGGCTGGCCCCATTCCACCATTGGATGGAGTCGTTCCTGGTTTCGATGCTATCATCGGACAGAAGGTC
GGTGGAGGTATCAGGCAGATTAGTGGTACCAACCCCAACGATCCCACTACGAACATCACGCTTCCGGACCAAGACTTCGTTGTCCCAAGGGGTGGAGAGTATTTCTTCTCGCCGTCCATC
ACGGCTTTGAAGACTAAGTTCGCTATTGGCGTTGCCTCTCCTGCTCCTCACTCCCAAGCTCCAATCTCTGCT

Retrieve as FASTA