Entry information : DsDyPrx (DyP1)
Entry ID 9890
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-02 (Catherine Mathe (Scipio))
Peroxidase information: DsDyPrx (DyP1)
Name (synonym) DsDyPrx (DyP1)
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Dichomitus
Organism Dichomitus squalens    [TaxId: 114155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DsDyPrx
start..stop
S start..stop
GsppDyPrx02 774 0 1..483 1..489
GsppDyPrx01 739 0 1..483 1..487
GsppDyPrx03 650 0 8..483 16..492
TvDyPrx01_other 639 0 1..483 1..485
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 43998..44050 53 N° 2 43708..43945 238 N° 3 43356..43654 299 N° 4 42998..43302 305
N° 5 42674..42944 271 N° 6 42554..42615 62 N° 7 42280..42500 221  
complement(join(42280..42500,42554..42615,42674..42944,42998..43302,43356..43654 ,43708..43945,43998..44050))


exon

Literature and cross-references DsDyPrx (DyP1)
DNA ref. JGI genome:   scaffold_73 (44050..42280)
Protein sequence: DsDyPrx (DyP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   484
PWM (Da):   %s   52232.81  
PI (pH):   %s   6.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSATLTPLNPANVQGDILVGLPKKVQHYLFFQIDNDVTSFRKRLGLLIPLITTTAQVQDDRAKIAANKEAAAKEGKAPELLKLSGVNIAFSQFGLTLGITDNVGDTAFVEGQLKDSQNLGDAGTTDAQGNFTPDWLPAFKNQIHGLIIISGDSELTVSATQATVMAIFNIGVHITLHEITTLKGVVRPGAEKGHEHFGFLDGISQPAVKEFDTKPNPGQETVRQGVILCGRENDVDANNNNTPFVRPPWALDGSFLALRYLFQLVPEFNTFLTQSADPTTGLSSDLLGARLVGRWKGAPVDVFPLQDNPEAGTDPSQNNNFRYDFPDDQQTQDRCPFAAHTRKTNPRADLEDLNISTESRRIIRRGVQFGPELTPAEISSGKTIEQRGLIFAAYSGSITNGFQFVQSWADNTGFPIKKPVTPGFDAIIGQNGNGPRSLSGANPKNQSATLALPANWVVPKGGEYFFSPSIPALRSTFAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGCAACTCTAACTCCCCTCAACCCCGCCAACGTCCAGGGCGATATCCTGTATGTCATACTCGGACGTTTCCTCTTGCTGCTAGCTGACTGTCCTTGACAGCGTCGGACTTCCGAA
GAAGGTTCAGCACTACCTCTTCTTCCAAATTGACAACGATGTCACTTCGTTCAGGAAGCGGTTGGGCCTGCTGATTCCCCTCATCACCACCACTGCCCAGGTTCAGGACGACCGGGCCAA
GATCGCCGCCAATAAGGAGGCGGCGGCTAAGGAGGGCAAAGCCCCGGAACTCTTGAAGCTCTCCGGTGTCAACATTGCCTTCTCTCAGTTTGGTCTCACCAAG
GTGACGTCTGACGACTG
ATTCAATGGAGTGTGTATTCACGACAACATGAGCAGCTTGGCATTACCGACAACGTCGGTGACACAGCTTTCGTCGAAGGCCAGCTTAAGGACTCTCAGAATCTCGGCGATGCCGGAACC
ACCGATGCCCAAGGAAACTTCACCCCTGACTGGCTGCCTGCATTCAAGAACCAGATTCATGGTCTCATCATCATCTCGGGCGACTCCGAGTTGACTGTCTCTGCGACACAAGCAACAGTG
ATGGCGATATTCAACATTGGCGTTCACATCACCCTTCACGAAATCACTACGCTAAAAGGCGTAGTCCGTCCCGGCGCCGAGAAGGGTCATGAACA
GTGAGAATCCTATACCATTGACGTT
GCAACTGCAGCTGAGATGCTATGTTCAGCTTTGGTTTCTTGGACGGCATTTCCCAACCCGCAGTCAAGGAATTCGACACGAAGCCCAACCCAGGACAGGAGACCGTCCGTCAGGGCGTTA
TCCTCTGTGGACGTGAGAACGATGTCGACGCCAACAACAACAATACGCCCTTCGTCCGCCCCCCTTGGGCTCTGGACGGCAGTTTCCTCGCCCTTCGCTATCTCTTCCAGCTGGTGCCGG
AGTTCAACACCTTCTTGACGCAGAGCGCAGACCCTACTACCGGTCTCTCCTCTGACCTTCTGGGAGCGCGGCTCGTCGGCCGGTGGAAGAGCG
GTACGAGAGTATCGTCTGTATTCCCGT
ATCCATTGTCCTTATCACGCCGTCAGGTGCTCCTGTGGACGTCTTCCCCTTGCAGGACAATCCCGAGGCTGGAACGGACCCGTCTCAGAACAACAACTTCAGGTACGACTTCCCGGATGA
CCAGCAGACTCAGGACCGCTGCCCGTTCGCGGCGCATACACGCAAGACAAATCCGAGAGCCGACCTCGAAGATCTCAATATCTCTACGGAGAGCAGGCGTATCATCCGACGCGGTGTCCA
GTTTGGGCCTGAACTCACCCCAGCAGAGATCTCGAGCGGTAAGACAATCGAGCAGCG
GTGAGTCATGATGATTGAGCGCGTCGTCCGCAAGTCTGGCTACTAATGATCTGCACAGCGGTC
TCATCTTTGCTGCCTATTCAGGAAGCATCACGAACGGCTTCCAATTTGTGCAGCATA
GTGCGTAGCTGGTGCCTGGTACAATGGTCTCGTAGCCGCTAACCCTTTGATAGGCTGGGCGGA
CAACACGGGTTTCCCTATTAAAAAGCCAGTCACCCCTGGTTTCGACGCCATCATTGGCCAGAATGGTAACGGCCCTCGCAGCTTATCGGGCGCAAACCCGAAGAACCAGAGCGCGACGCT
CGCGCTTCCCGCCAACTGGGTCGTCCCCAAGGGCGGAGAATACTTCTTCTCGCCTTCGATCCCTGCTCTTCGCAGTACCTTCGCTTTGGCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGCAACTCTAACTCCCCTCAACCCCGCCAACGTCCAGGGCGATATCCTCGTCGGACTTCCGAAGAAGGTTCAGCACTACCTCTTCTTCCAAATTGACAACGATGTCACTTCGTTC
AGGAAGCGGTTGGGCCTGCTGATTCCCCTCATCACCACCACTGCCCAGGTTCAGGACGACCGGGCCAAGATCGCCGCCAATAAGGAGGCGGCGGCTAAGGAGGGCAAAGCCCCGGAACTC
TTGAAGCTCTCCGGTGTCAACATTGCCTTCTCTCAGTTTGGTCTCACCAAG
CTTGGCATTACCGACAACGTCGGTGACACAGCTTTCGTCGAAGGCCAGCTTAAGGACTCTCAGAATCTC
GGCGATGCCGGAACCACCGATGCCCAAGGAAACTTCACCCCTGACTGGCTGCCTGCATTCAAGAACCAGATTCATGGTCTCATCATCATCTCGGGCGACTCCGAGTTGACTGTCTCTGCG
ACACAAGCAACAGTGATGGCGATATTCAACATTGGCGTTCACATCACCCTTCACGAAATCACTACGCTAAAAGGCGTAGTCCGTCCCGGCGCCGAGAAGGGTCATGAACA
CTTTGGTTTC
TTGGACGGCATTTCCCAACCCGCAGTCAAGGAATTCGACACGAAGCCCAACCCAGGACAGGAGACCGTCCGTCAGGGCGTTATCCTCTGTGGACGTGAGAACGATGTCGACGCCAACAAC
AACAATACGCCCTTCGTCCGCCCCCCTTGGGCTCTGGACGGCAGTTTCCTCGCCCTTCGCTATCTCTTCCAGCTGGTGCCGGAGTTCAACACCTTCTTGACGCAGAGCGCAGACCCTACT
ACCGGTCTCTCCTCTGACCTTCTGGGAGCGCGGCTCGTCGGCCGGTGGAAGAGCG
GTGCTCCTGTGGACGTCTTCCCCTTGCAGGACAATCCCGAGGCTGGAACGGACCCGTCTCAGAAC
AACAACTTCAGGTACGACTTCCCGGATGACCAGCAGACTCAGGACCGCTGCCCGTTCGCGGCGCATACACGCAAGACAAATCCGAGAGCCGACCTCGAAGATCTCAATATCTCTACGGAG
AGCAGGCGTATCATCCGACGCGGTGTCCAGTTTGGGCCTGAACTCACCCCAGCAGAGATCTCGAGCGGTAAGACAATCGAGCAGCG
CGGTCTCATCTTTGCTGCCTATTCAGGAAGCATC
ACGAACGGCTTCCAATTTGTGCAGCATA
GCTGGGCGGACAACACGGGTTTCCCTATTAAAAAGCCAGTCACCCCTGGTTTCGACGCCATCATTGGCCAGAATGGTAACGGCCCTCGCAGC
TTATCGGGCGCAAACCCGAAGAACCAGAGCGCGACGCTCGCGCTTCCCGCCAACTGGGTCGTCCCCAAGGGCGGAGAATACTTCTTCTCGCCTTCGATCCCTGCTCTTCGCAGTACCTTC
GCTTTGGCG

Retrieve as FASTA