Entry information : FmeDyPrx03 (Fomme-DyP3)
Entry ID 9894
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-22 (Catherine Mathe (Scipio))
Peroxidase information: FmeDyPrx03 (Fomme-DyP3)
Name (synonym) FmeDyPrx03 (Fomme-DyP3)
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeDyPrx03
start..stop
S start..stop
FmeDyPrx01 583 0 2..473 5..469
FmeDyPrx02 570 0 15..473 17..470
BbotDyPrx03 498 4e-174 3..473 37..518
TvDyPrx02 417 4e-143 8..472 7..486
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 244811..244850 40 N° 2 244750..244759 10 N° 3 244472..244691 220 N° 4 244260..244412 153
N° 5 244062..244196 135 N° 6 243849..244003 155 N° 7 243500..243796 297 N° 8 243258..243433 176
N° 9 243116..243193 78 N° 10 242904..243061 158  
complement(join(242904..243061,243116..243193,243258..243433,243500..243796,2438 49..244003,244062..244196,244260..244412,244472..244691,244750..244759,244811..2 44850))


exon

Literature and cross-references FmeDyPrx03 (Fomme-DyP3)
DNA ref. JGI genome:   scaffold_17 (244850..242904)
Protein sequence: FmeDyPrx03 (Fomme-DyP3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   474
PWM (Da):   %s   52156.19  
PI (pH):   %s   5.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSWPTPADLDDLQGDVVLGLPKRAETFIFFNIANVANFKKSLQQFIPAVTTTTQVQQLRKEIADHKLTGSPDLLQIQCMNFALSRRGMKELGVTDDLRDGPFNDGQKAHAQPLGDNGKQSLLSFDPDWLLPFKNEVDGVFLITGDSDSTVLDGINKVNNTFSGSFTEMLKVEGRVRPGKEKGHEHFGFRDGISFPAIRGFVDPFPGQTQVDPGVIVCKTNGDGVLFRPDWAKNGSFLVYRHLQQFVPEFNTFVENNPVADSQVAAENQVELAGARMFGRWKSGAPTALSPFADDPALADDPQKNNNFNFSEVNLNDQTRCPFAAHVRKSNPRKDLTSVPAFGEAFVESHMISRQSVPYGPEVDPDAEKFTTVNDRGLAFVCYQSNIDNGFEFVQKTWANDVLFPPLKLNGILPLVPGFDPIIGQNNGNDRQMAGLQIDHPAQDTKLPIEFVVSKGGAYFFSPSITALKTKFSV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTGGCCAACACCAGCGGATCTTGATGACCTTCAGGGTGAGATTCATTTGATAGGGCTACAGCACTTACTGATATAACTCGATGCAGGTGATGTTGTGTACGCATGTCATGCCCCA
CAGCGTGTACGAAAACTGATTTACTTCATATCCATTCAGTCTCGGACTTCCAAAGCGCGCAGAAACCTTCATTTTCTTCAATATTGCGAATGTTGCCAATTTCAAGAAATCTCTCCAACA
GTTTATACCAGCCGTCACGACAACGACCCAGGTCCAGCAGTTGCGGAAGGAGATCGCTGACCACAAACTCACGGGTTCGCCGGACCTGTTGCAGATCCAATGCATGAATTTTGCTCTATC
ACGTCGTGGAATGAAGGAG
GTACGTACTATTACTAACTGAAGAACAAGCCTCTTTTAATTTGCATCTTCTACCTCAAGCTCGGAGTTACCGACGATCTAAGGGATGGGCCGTTCAACGAT
GGGCAAAAGGCGCATGCCCAGCCTCTGGGCGACAACGGAAAGCAGAGCCTGCTCTCTTTTGATCCAGACTGGCTTCTGCCTTTCAAGAACGAGGTCGATGGTGTCTTCTTG
GTAAGAATT
AGTAACAATACCTCTCATTTGATCGCACGCTATAGCATGTTTACTTTGAAACAGATTACGGGTGACTCAGACTCCACTGTCCTTGATGGTATCAACAAAGTCAATAATACTTTCAGCGGT
TCCTTCACGGAAATGCTCAAGGTTGAGGGTCGTGTGCGCCCCGGGAAGGAGAAAGGCCATGAGCACTTT
GTCAGTCTTTATGAACTATTCCTCGTACTGGTTTTCTTATTCTCCATCTGA
CACGAAGGGATTCCGTGATGGCATTTCTTTCCCTGCAATTAGAGGCTTTGTCGATCCTTTTCCAGGTCAGACTCAGGTGGATCCAGGTGTAATTGTATGCAAAACAAATGGTGATGGTGT
ACTGTTTCGTCCCGACTGGGCGAAGAACGGATCCTTCCTAGT
GTAAGTAATTTCCTCAATCTCTTGGTTGTATCTCATTATAACTCGTAAAAAGATATCGCCATCTACAGCAATTTGTTC
CGGAATTTAACACGTTCGTCGAGAACAACCCAGTTGCCGATTCGCAGGTAGCAGCTGAAAACCAAGTGGAACTAGCGGGAGCAAGAATGTTTGGACGCTGGAAGAGCGGGGCGCCGACTG
CCCTCTCTCCGTTCGCAGATGATCCCGCTCTTGCGGACGATCCGCAAAAGAACAACAACTTCAACTTCTCAGAAGTCAACTTAAATGACCAGACTAGGTGTCCCTTTGCAGCACACGTTC
GCAAGTCAAACCCGAGGAAGGATTTAACAAG
GTGTGTGCTATTTATTGCCGATGAACAGCTTGAGCTCACCAATTGGTATTCAATACTATTGTTTAGTGTTCCGGCTTTCGGAGAAGCAT
TCGTGGAGTCACACATGATAAGCCGTCAGAGCGTTCCCTATGGACCAGAAGTAGACCCAGATGCCGAGAAATTCACGACAGTAAATGATCGTGGCCTTGCCTTCGTTTGCTATCAAAGTA
ACATTGACAATGGTTTCGAGTTTGTCCAAAAGA
GTACGTCTTTGATATTTTGTCAGACCTCATTCGACAGGGGTGGCTAAATCGACCATCCTTGCAGCATGGGCCAATGACGTGCTGTTC
CCACCCCTGAAGCTTAATGGGATTCTCCCTCTTGTCCCAGGTTTCGACCCTATCA
GTGCGTCAATTCCTATTTACCTTCATCGAGAATCTTAAATAATACCCCATTCAGTCGGTCAGAAC
AATGGCAACGATCGTCAAATGGCGGGTCTTCAGATTGACCACCCGGCTCAGGATACAAAGCTTCCCATAGAATTCGTCGTGTCGAAGGGGGGAGCGTACTTTTTCTCGCCATCTATCACC
GCGCTCAAGACCAAGTTCTCCGTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTGGCCAACACCAGCGGATCTTGATGACCTTCAGGGTGATGTTGTTCTCGGACTTCCAAAGCGCGCAGAAACCTTCATTTTCTTCAATATTGCGAATGTTGCCAATTTCAAGAAA
TCTCTCCAACAGTTTATACCAGCCGTCACGACAACGACCCAGGTCCAGCAGTTGCGGAAGGAGATCGCTGACCACAAACTCACGGGTTCGCCGGACCTGTTGCAGATCCAATGCATGAAT
TTTGCTCTATCACGTCGTGGAATGAAGGAG
CTCGGAGTTACCGACGATCTAAGGGATGGGCCGTTCAACGATGGGCAAAAGGCGCATGCCCAGCCTCTGGGCGACAACGGAAAGCAGAGC
CTGCTCTCTTTTGATCCAGACTGGCTTCTGCCTTTCAAGAACGAGGTCGATGGTGTCTTCTTG
ATTACGGGTGACTCAGACTCCACTGTCCTTGATGGTATCAACAAAGTCAATAATACT
TTCAGCGGTTCCTTCACGGAAATGCTCAAGGTTGAGGGTCGTGTGCGCCCCGGGAAGGAGAAAGGCCATGAGCACTTT
GGATTCCGTGATGGCATTTCTTTCCCTGCAATTAGAGGCTTT
GTCGATCCTTTTCCAGGTCAGACTCAGGTGGATCCAGGTGTAATTGTATGCAAAACAAATGGTGATGGTGTACTGTTTCGTCCCGACTGGGCGAAGAACGGATCCTTCCTAGT
ATATCGC
CATCTACAGCAATTTGTTCCGGAATTTAACACGTTCGTCGAGAACAACCCAGTTGCCGATTCGCAGGTAGCAGCTGAAAACCAAGTGGAACTAGCGGGAGCAAGAATGTTTGGACGCTGG
AAGAGCGGGGCGCCGACTGCCCTCTCTCCGTTCGCAGATGATCCCGCTCTTGCGGACGATCCGCAAAAGAACAACAACTTCAACTTCTCAGAAGTCAACTTAAATGACCAGACTAGGTGT
CCCTTTGCAGCACACGTTCGCAAGTCAAACCCGAGGAAGGATTTAACAAG
TGTTCCGGCTTTCGGAGAAGCATTCGTGGAGTCACACATGATAAGCCGTCAGAGCGTTCCCTATGGACCA
GAAGTAGACCCAGATGCCGAGAAATTCACGACAGTAAATGATCGTGGCCTTGCCTTCGTTTGCTATCAAAGTAACATTGACAATGGTTTCGAGTTTGTCCAAAAGA
CATGGGCCAATGAC
GTGCTGTTCCCACCCCTGAAGCTTAATGGGATTCTCCCTCTTGTCCCAGGTTTCGACCCTATCA
TCGGTCAGAACAATGGCAACGATCGTCAAATGGCGGGTCTTCAGATTGACCACCCG
GCTCAGGATACAAAGCTTCCCATAGAATTCGTCGTGTCGAAGGGGGGAGCGTACTTTTTCTCGCCATCTATCACCGCGCTCAAGACCAAGTTCTCCGTCTGA

Retrieve as FASTA