Entry information : FmeDyPrx02 (Fomme-DyP2)
Entry ID 9895
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-22 (Catherine Mathe (Scipio))
Peroxidase information: FmeDyPrx02 (Fomme-DyP2)
Name (synonym) FmeDyPrx02 (Fomme-DyP2)
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeDyPrx02
start..stop
S start..stop
FmeDyPrx01 580 0 17..470 18..469
FmeDyPrx03 570 0 17..470 15..473
BbotDyPrx03 489 9e-171 20..470 56..518
CsuDyPrx01 432 5e-149 20..470 20..480
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 527411..527686 276 N° 2 527738..527890 153 N° 3 527950..528084 135 N° 4 528144..528295 152
N° 5 528349..528642 294 N° 6 528709..528890 182 N° 7 528950..529012 63 N° 8 529067..529221 155
join(527411..527686,527738..527890,527950..528084,528144..528295,528349..528642, 528709..528890,528950..529012,529067..529221)


exon

Literature and cross-references FmeDyPrx02 (Fomme-DyP2)
DNA ref. JGI genome:   scaffold_17 (527411..529221)
Protein sequence: FmeDyPrx02 (Fomme-DyP2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   471
PWM (Da):   %s   50921.87  
PI (pH):   %s   4.82
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFLCISIDCEVLTSAFELSLGIPKFAEDFLFFNITNVANFKNDLKQIVPSITTTTQVQKMQQQIAQNKLAGIVDLVKISAINIAFTESGLKKLGVTDDLGDQSFNAGQIESAKDLGDGTTDSSGNFDPGWLDAFKNGVDGIFLFGGDSDVSILEGEAKVRLVFATSISEALTVPGRVRPDKEKGHEHFGFKDGISFPAIKGMVDPLPGQIEVSPGVIVCGTDGDTVSRPAWAKNGSFLVYRHLKQFVPEFNAFLKNNPIVDPRVASADQNELVGARMFGRWKSGAPIELAPFADDPTLAGDAQRNNNFDFSDSSTDQTICPFAAHIRKTNPRADLLKIPGGGGSPDFLLPRMINRQSIPFGPEVNPLLEAEKTVLDRGLAFVCYQSNITAGFEFVQKSWVNTESFPPQKPVQPGFDPIIGQKNGAEREMTGLNPNAQSQQTKLPFEFVQSKGGAYFFSPSISALTTKLSV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCTTTGCATTAGCATCGATTGCGAAGTGCTTACATCTGCCTTCGAACTCAGTCTCGGTATTCCCAAGTTCGCTGAAGACTTTTTGTTCTTCAATATCACCAACGTCGCCAATTTC
AAGAATGACCTTAAGCAGATCGTCCCTTCCATCACAACGACAACACAGGTTCAAAAGATGCAGCAGCAGATTGCGCAAAACAAGCTCGCTGGTATAGTTGACCTGGTCAAGATATCTGCG
ATAAACATCGCATTTACAGAGTCAGGCCTGAAGAAG
GTATGGGAACCTGATCTTAACAGATGTACTGTTACTAATAGAACGATAAAGTTGGGCGTCACTGACGACCTTGGAGACCAATCG
TTCAATGCTGGACAAATCGAAAGCGCCAAGGACCTTGGGGACGGAACGACAGATTCTTCTGGCAACTTTGACCCCGGCTGGCTTGATGCTTTTAAGAACGGCGTTGATGGTATCTTCCTG
GTACGTGTACAATACAAGAGATACATTCTGGGAATTTTTATTGATAATCATTTCGGCAGTTCGGTGGAGACTCAGATGTATCCATTCTTGAAGGCGAGGCAAAAGTCCGGCTTGTCTTCG
CTACCTCTATTTCGGAGGCTCTCACCGTTCCCGGTCGTGTTCGTCCGGACAAAGAGAAGGGTCATGAGCACTTT
GTTAGTTCCTTCACGATTGTTAACTCAATTGGCGCTAAACGTAACC
AATTGATAAATAGGGCTTCAAAGACGGAATCTCGTTCCCTGCAATCAAAGGAATGGTTGATCCTCTACCAGGCCAGATCGAGGTCTCCCCTGGTGTTATTGTTTGCGGTACCGATGGTGA
CACCGTCTCCCGGCCCGCTTGGGCGAAGAACGGATCTTTCCTCGT
GTCAGTGTTTTCTTCTAACAAAAAGCCGACACACCTAAACCTTTTGCATATAGGTACCGCCACCTGAAACAATTT
GTTCCGGAATTCAACGCATTCCTCAAAAACAACCCGATCGTTGACCCTCGCGTAGCAAGTGCTGACCAGAATGAGCTGGTCGGCGCCCGGATGTTCGGACGCTGGAAGAGCGGCGCGCCG
ATTGAACTTGCTCCGTTTGCAGACGATCCTACTCTAGCAGGTGACGCACAGAGAAACAATAACTTCGACTTCTCGGATAGCTCGACCGACCAGACAATTTGTCCCTTCGCCGCGCACATC
CGTAAGACAAACCCAAGGGCTGATTTGCTCAA
GTACGTACTTGTCATGACCGCGTACTACTCGCATAGGCCTAAATTCATAATATTGATGACACTTAGAATACCCGGAGGTGGTGGTTCC
CCAGACTTCCTGCTGCCACGCATGATCAATCGTCAAAGCATTCCTTTCGGGCCAGAGGTCAATCCGCTCTTAGAAGCGGAAAAGACGGTGCTTGATCGCGGACTTGCCTTTGTCTGTTAC
CAAAGCAACATCACCGCTGGCTTTGAGTTCGTCCAGAAAT
GTAAGAATCACAGTTCTTCTCTCTTGTAAAAAAGAATAATGTAGATTTGCATTGTGCAGCATGGGTTAACACGGAATCGT
TCCCACCTCAGAAGCCAGTCCAGCCAGGATTTGATCCTATCA
GTAAGTTGTACATGTCCAGGTTCATTACGGATAGTGCACTGACTACTATTACAGTTGGCCAGAAAAATGGCGCAGAAC
GCGAGATGACTGGTCTCAACCCGAATGCCCAGTCTCAACAGACGAAGCTGCCATTTGAATTTGTCCAGTCGAAGGGAGGAGCGTATTTCTTCTCGCCATCCATCAGTGCACTCACGACAA
AGCTTTCTGTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCTTTGCATTAGCATCGATTGCGAAGTGCTTACATCTGCCTTCGAACTCAGTCTCGGTATTCCCAAGTTCGCTGAAGACTTTTTGTTCTTCAATATCACCAACGTCGCCAATTTC
AAGAATGACCTTAAGCAGATCGTCCCTTCCATCACAACGACAACACAGGTTCAAAAGATGCAGCAGCAGATTGCGCAAAACAAGCTCGCTGGTATAGTTGACCTGGTCAAGATATCTGCG
ATAAACATCGCATTTACAGAGTCAGGCCTGAAGAAG
TTGGGCGTCACTGACGACCTTGGAGACCAATCGTTCAATGCTGGACAAATCGAAAGCGCCAAGGACCTTGGGGACGGAACGACA
GATTCTTCTGGCAACTTTGACCCCGGCTGGCTTGATGCTTTTAAGAACGGCGTTGATGGTATCTTCCTG
TTCGGTGGAGACTCAGATGTATCCATTCTTGAAGGCGAGGCAAAAGTCCGG
CTTGTCTTCGCTACCTCTATTTCGGAGGCTCTCACCGTTCCCGGTCGTGTTCGTCCGGACAAAGAGAAGGGTCATGAGCACTTT
GGCTTCAAAGACGGAATCTCGTTCCCTGCAATCAAA
GGAATGGTTGATCCTCTACCAGGCCAGATCGAGGTCTCCCCTGGTGTTATTGTTTGCGGTACCGATGGTGACACCGTCTCCCGGCCCGCTTGGGCGAAGAACGGATCTTTCCTCGT
GTAC
CGCCACCTGAAACAATTTGTTCCGGAATTCAACGCATTCCTCAAAAACAACCCGATCGTTGACCCTCGCGTAGCAAGTGCTGACCAGAATGAGCTGGTCGGCGCCCGGATGTTCGGACGC
TGGAAGAGCGGCGCGCCGATTGAACTTGCTCCGTTTGCAGACGATCCTACTCTAGCAGGTGACGCACAGAGAAACAATAACTTCGACTTCTCGGATAGCTCGACCGACCAGACAATTTGT
CCCTTCGCCGCGCACATCCGTAAGACAAACCCAAGGGCTGATTTGCTCAA
AATACCCGGAGGTGGTGGTTCCCCAGACTTCCTGCTGCCACGCATGATCAATCGTCAAAGCATTCCTTTC
GGGCCAGAGGTCAATCCGCTCTTAGAAGCGGAAAAGACGGTGCTTGATCGCGGACTTGCCTTTGTCTGTTACCAAAGCAACATCACCGCTGGCTTTGAGTTCGTCCAGAAAT
CATGGGTT
AACACGGAATCGTTCCCACCTCAGAAGCCAGTCCAGCCAGGATTTGATCCTATCA
TTGGCCAGAAAAATGGCGCAGAACGCGAGATGACTGGTCTCAACCCGAATGCCCAGTCTCAACAG
ACGAAGCTGCCATTTGAATTTGTCCAGTCGAAGGGAGGAGCGTATTTCTTCTCGCCATCCATCAGTGCACTCACGACAAAGCTTTCTGTA

Retrieve as FASTA