Entry information : AdelDyPrx11 (DyP11)
Entry ID 9906
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: AdelDyPrx11 (DyP11)
Name (synonym) AdelDyPrx11 (DyP11)
Class DyP-type peroxidase D    [Orthogroup: DyPrxD002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelDyPrx11
start..stop
S start..stop
AdelDyPrx07 576 0 41..499 1..460
AdelDyPrx09 562 0 1..499 1..537
AdelDyPrx04 526 0 24..497 5..471
AdelDyPrx06 513 1e-179 14..497 11..514
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 116836..116965 130 N° 2 117024..117108 85 N° 3 117163..117608 446 N° 4 117660..117770 111
N° 5 117831..118015 185 N° 6 118065..118207 143 N° 7 118258..118331 74 N° 8 118387..118656 270
N° 9 118707..118762 56  
join(116836..116965,117024..117108,117163..117608,117660..117770,117831..118015, 118065..118207,118258..118331,118387..118656,118707..118762)


exon

Literature and cross-references AdelDyPrx11 (DyP11)
DNA ref. JGI genome:   scaffold_17 (116836..118762)
Protein sequence: AdelDyPrx11 (DyP11)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   500 (480)
PWM (Da):   %s   53424.16 (51312.1)  
PI (pH):   %s   6.19 (6.18) Peptide Signal:   %s   cut: 20 range:20-499
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRPSSFLFVLAFGLDAAFARRAAPRATQNPAGVTGTRKSSFLKNVAGIPPVPPAAKVAATAFPVNDIQGDIIVGMQKPKELFYFFSIGDAASFKTHLAKDIAPILTSAEQMLNTTQQPLVLLNMAFSQAGLTTLGVLDSLGDTSFTLGQIKAIQTLAEKSDGWQQEFKGTGIHGVMLLASDTVDLINQQVAFLETTFGSSMRKVYALDGAMRPGALAGHMFGYKDGIAQPALDGFGDTHPGQLVVPPGMILTGMDGDSGVRPVDGWMTGGSFLVFRQLEQLVPEFDKFLLDNAPIVEGKTLQERADLLGARMVGRWKGAPIDLSPNQDDPALGNDVNRNNNFDFTHDGLDFKSDQSRCPFSAHIRKSRPRADVSSNISIMRSGIPYGGVTAAEAASNTTSQARGLAFVSYQSSIAKGFEFIQKAWVNAPGFVFGKDVQPGFDPIVGQNFGGPRNVTGLDPNDTHKQLTLPLEFVVSRGGEYFFSPPISAFTGRLVA

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCCCCTCGTCATTCCTTTTTGTTCTCGCTTTTGGCCTCGACGCTGCCTTTGCGCGTCGTGCGGCTCCAAGGGCCACGCAGAACCCTGCAGGCGTCACAGGCACGCGCAAGTCATCC
TTCCTGAAGA
GTGAGTGCTGTGTTAAAGCTGCTTGCGCGCAGTCTGCTCACGATATGTGTCGCGGCAGACGTTGCTGGCATTCCTCCTGTACCACCTGCTGCCAAGGTTGCAGCCACCGC
GTTTCCCGTCAATGACATCCAAGGAGACATCAT
GTACGTGAATCCTGATCCCATAGCTCTTCAACAAGGCTGAATGACGCGTCACAGCGTTGGGATGCAGAAGCCGAAAGAGCTCTTCTA
CTTTTTCTCCATCGGCGATGCGGCCTCGTTCAAGACTCATCTCGCGAAGGACATCGCGCCGATCCTTACCTCGGCAGAGCAAATGTTGAACACGACGCAGCAGCCGCTCGTTCTTCTCAA
CATGGCGTTCTCTCAGGCCGGCCTGACCACCCTCGGCGTTCTTGACAGCCTCGGCGACACGTCCTTCACTCTCGGCCAGATCAAGGCCATCCAGACGCTCGCCGAGAAGTCGGATGGCTG
GCAGCAGGAGTTCAAGGGCACTGGCATCCACGGCGTCATGCTCCTCGCGAGCGACACGGTGGATCTCATCAACCAGCAAGTCGCGTTCCTCGAGACGACCTTCGGCTCGTCGATGCGCAA
GGTGTACGCACTCGATGGCGCAATGCGCCCCGGAGCGTTGGCCGGCCACGAGA
GTATGTGTGATGCATTTGTCTCCGCGTGGGTAGCTGACGGCGACGCGATAGTGTTTGGCTACAAAGA
TGGTATTGCGCAGCCGGCGCTTGACGGTTTCGGCGACACGCATCCCGGCCAGCTGGTGGTCCCTCCTGGCATGATTCTTACTGGAATGGACGGAG
GTGTGTCTCCCCATTCCCCTCCCTT
GTCTATTGTCTATTGATTTAAAGCTCTTGATTCAGACAGCGGTGTGCGTCCCGTGGACGGATGGATGACGGGCGGCTCGTTCCTCGTCTTCCGGCAATTGGAGCAGCTCGTGCCCGAGTT
CGACAAGTTCCTGCTCGACAACGCGCCCATCGTCGAGGGCAAGACTTTACAGGAGCGTGCAGATCTTCTTGGCGCGCGTATGGTAGGACGCTGGAAGTCG
GTATGTGACCCGACTTTGCC
TGTCCTGCGAGCATTCATGTTATCATCAGGGCGCCCCGATCGATTTGTCTCCCAACCAAGACGACCCGGCGCTTGGGAACGACGTGAACCGGAACAACAACTTCGACTTCACCCACGACG
GCCTGGACTTCAAGTCGGACCAGAGTCGCTGCCCGTTCAGCGCGCACATCAG
GTAAGCCCTGGTAGTGGTCCTTCGTGAATTTGCACTGAGAAACGGTTCAGAAAAAGCCGCCCGCGTGC
TGACGTGTCGTCAAATATCAGCATTATGCGGTCCGGTATCCCTTACGGTGGAGAAG
GTGCGAATTCAGGCATCCTGCCTGGTTTGGGCCGCTTACTGACACCGTCCTGTAGTCACGGCCG
CGGAAGCCGCATCGAACACGACGTCTCAGGCGCGCGGCCTTGCCTTTGTTTCGTACCAGTCTAGCATCGCCAAAGGCTTTGAGTTCATTCAGAAAGCTTGGGTCAACGCACCAGGTTTTG
TCTTCGGCAAGGACGTCCAGCCCGGCTTCGATCCCATCGTAGGACAGAACTTCGGAGGACCTCGCAACGTGACTGGTCTCGATCCCAACGACACGCACAAGCAGCTCACCCTTCCGCTGG
AGTTCGTCGTGAGCCGCGGAG
GTAAGTGAAGTATTTCCAAGTGAACAAGGACACAGCTAATTACGTTTCAGGCGAGTACTTCTTCTCTCCACCGATCTCCGCCTTTACTGGGAGACTCGT
TGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCCCCTCGTCATTCCTTTTTGTTCTCGCTTTTGGCCTCGACGCTGCCTTTGCGCGTCGTGCGGCTCCAAGGGCCACGCAGAACCCTGCAGGCGTCACAGGCACGCGCAAGTCATCC
TTCCTGAAGA
ACGTTGCTGGCATTCCTCCTGTACCACCTGCTGCCAAGGTTGCAGCCACCGCGTTTCCCGTCAATGACATCCAAGGAGACATCATCGTTGGGATGCAGAAGCCGAAAGAG
CTCTTCTACTTTTTCTCCATCGGCGATGCGGCCTCGTTCAAGACTCATCTCGCGAAGGACATCGCGCCGATCCTTACCTCGGCAGAGCAAATGTTGAACACGACGCAGCAGCCGCTCGTT
CTTCTCAACATGGCGTTCTCTCAGGCCGGCCTGACCACCCTCGGCGTTCTTGACAGCCTCGGCGACACGTCCTTCACTCTCGGCCAGATCAAGGCCATCCAGACGCTCGCCGAGAAGTCG
GATGGCTGGCAGCAGGAGTTCAAGGGCACTGGCATCCACGGCGTCATGCTCCTCGCGAGCGACACGGTGGATCTCATCAACCAGCAAGTCGCGTTCCTCGAGACGACCTTCGGCTCGTCG
ATGCGCAAGGTGTACGCACTCGATGGCGCAATGCGCCCCGGAGCGTTGGCCGGCCACGAGA
TGTTTGGCTACAAAGATGGTATTGCGCAGCCGGCGCTTGACGGTTTCGGCGACACGCAT
CCCGGCCAGCTGGTGGTCCCTCCTGGCATGATTCTTACTGGAATGGACGGAG
ACAGCGGTGTGCGTCCCGTGGACGGATGGATGACGGGCGGCTCGTTCCTCGTCTTCCGGCAATTGGAG
CAGCTCGTGCCCGAGTTCGACAAGTTCCTGCTCGACAACGCGCCCATCGTCGAGGGCAAGACTTTACAGGAGCGTGCAGATCTTCTTGGCGCGCGTATGGTAGGACGCTGGAAGTCG
GGC
GCCCCGATCGATTTGTCTCCCAACCAAGACGACCCGGCGCTTGGGAACGACGTGAACCGGAACAACAACTTCGACTTCACCCACGACGGCCTGGACTTCAAGTCGGACCAGAGTCGCTGC
CCGTTCAGCGCGCACATCAG
AAAAAGCCGCCCGCGTGCTGACGTGTCGTCAAATATCAGCATTATGCGGTCCGGTATCCCTTACGGTGGAGAAGTCACGGCCGCGGAAGCCGCATCGAAC
ACGACGTCTCAGGCGCGCGGCCTTGCCTTTGTTTCGTACCAGTCTAGCATCGCCAAAGGCTTTGAGTTCATTCAGAAAGCTTGGGTCAACGCACCAGGTTTTGTCTTCGGCAAGGACGTC
CAGCCCGGCTTCGATCCCATCGTAGGACAGAACTTCGGAGGACCTCGCAACGTGACTGGTCTCGATCCCAACGACACGCACAAGCAGCTCACCCTTCCGCTGGAGTTCGTCGTGAGCCGC
GGAG
GCGAGTACTTCTTCTCTCCACCGATCTCCGCCTTTACTGGGAGACTCGTTGCATGA

Retrieve as FASTA