Entry information : AdelDyPrx10 (DyP10)
Entry ID 9907
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: AdelDyPrx10 (DyP10)
Name (synonym) AdelDyPrx10 (DyP10)
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelDyPrx10
start..stop
S start..stop
AdelDyPrx01 504 7e-177 8..465 42..495
AdelDyPrx08 494 5e-174 37..467 1..435
AdelDyPrx07 491 1e-172 7..465 4..458
GluxDyPrx06 483 2e-168 24..467 77..516
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 140324..140424 101 N° 2 140139..140272 134 N° 3 139771..140085 315 N° 4 139442..139712 271
N° 5 139225..139389 165 N° 6 139096..139172 77 N° 7 138965..139047 83 N° 8 138655..138912 258
complement(join(138655..138912,138965..139047,139096..139172,139225..139389,1394 42..139712,139771..140085,140139..140272,140324..140424))


exon

Literature and cross-references AdelDyPrx10 (DyP10)
DNA ref. JGI genome:   scaffold_87 (140424..138655)
Protein sequence: AdelDyPrx10 (DyP10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   467
PWM (Da):   %s   50158.51  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLTGGSEIPGLVPFPKAAANDAALPFNDIQGDILAGMKKNKQAFYFFSIQNPKKFKVVLHTLIAPFLTSTKQLMNVTQPIVALNLAFSQSGLTALGITDNLGDPEFTAGQFADAEFLGDPGTGNWKPAFRGTKIHGVFLMASDKQPFIDLMVLLVRGLFFNIINEEYILNGNVRPGAEAGHEMFGYLDGIAQPSIPAFQAPFPGQQVIDPGVLLLNTTGDPIPRPAWTKFGSFLAFRQLQQLVPEFDGFVKASAPTIPGLTTGQSADLLGARMIGRWKSGAPVDLFPLTDGGSAVGNDPFQNNNFDFQHAGFNFTTDQTHCPFDAHIRKTRPRADLVAPANSIMRSGIPYGPVTAAEKAAGRSDPADGPRERGLAFVSYAQIAKGFRFLQHSWANNPGFIFNKDVDPGHDPIIGANAGAPRTMQGFNAADTTQSLALPVDWVVSRGGEYFFAPSISSIKNFISV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGACGGGAGGCTCAGAAATCCCTGGTTTAGTCCCGTTCCCTAAAGCTGCTGCGAATGACGCCGCGTTGCCATTCAATGATATTCAGGGCGACATCCTGTAAGTTCCTCAAGTCAAA
TCCGTCTCGGAGACTAACAGGGCGGTTCACAGGGCAGGGATGAAGAAGAACAAGCAAGCGTTCTACTTCTTCTCCATTCAGAACCCGAAGAAGTTCAAAGTGGTTCTGCATACGCTCATC
GCGCCGTTCCTCACGTCCACGAAGCAGCTCATGAATGTCACAAACC
GTACGGCTGGATCAGACCAGATCCGATCGTTTATTTACTCAAACACCGTCCAGAGCCTATCGTCGCACTTAATC
TCGCGTTCAGCCAATCGGGTTTGACGGCCCTGGGCATCACGGACAACCTCGGGGATCCAGAGTTCACTGCAGGCCAGTTCGCCGATGCGGAATTCCTCGGCGACCCCGGCACGGGTAACT
GGAAGCCTGCGTTCCGCGGAACAAAGATCCACGGCGTCTTCCTCATGGCAAGCGACAAGCAGCCCTTCATCGACCTCATGGTCCTCCTCGTCCGCGGTCTTTTCTTCAACATCATCAACG
AGGAGTACATCCTGAACGGCAACGTTCGGCCGGGTGCTGAGGCCGGACACGAGA
GTACGTCTTCTCCCTGCACTGGTGCGGCTTTACAGGCGTTGATGGAACTCCTTGACAGTGTTTGGC
TACCTGGACGGCATCGCCCAGCCCAGCATTCCGGCATTCCAGGCGCCATTCCCGGGCCAGCAGGTCATTGACCCTGGCGTGCTCCTCCTCAACACGACCGGCGATCCCATTCCCCGCCCT
GCCTGGACCAAGTTCGGCTCCTTCCTTGCGTTCCGCCAGCTGCAACAGCTCGTTCCCGAGTTTGATGGCTTCGTGAAGGCCTCCGCGCCGACAATCCCGGGTCTCACAACCGGCCAGAGT
GCTGATCTCCTCGGAGCGCGCAT
GTAAGTCCAGCTCTCCCGCGACCGACTCCGAACGGTAGCTCATCTGGTGCAGGATCGGACGCTGGAAAAGCGGCGCACCAGTCGATCTGTTCCCGCT
CACTGACGGCGGATCCGCTGTTGGCAACGACCCGTTCCAGAACAACAACTTCGACTTCCAGCACGCCGGCTTCAACTTCACGACGGACCAGACGCACTGCCCCTTTGACGCGCACATTCG
GTACGAGAGAAGCTCTTCTCCACGCTGTGCAGTGTTACTCAGACTTTTACAGTAAAACCCGTCCCCGCGCCGATCTCGTCGCCCCCGCTAACTCCATCATGCGCTCAGGCATCCCGTATG
GCCCAGAAG
GTACGTCTCTTCTATCTCCATTGAGGCACATAGCTCACATTCATTAAGTCACTGCCGCTGAGAAGGCTGCCGGGCGCTCGGACCCTGCAGATGGTCCGCGCGAGCGCGGCC
TTGCGTTTGTTTCCTACCAG
GTATGGATGCGACCTGCGATAATATCTCGGAGGCTGACTATAGTATTCTAAGGCTCAGATCGCTAAGGGCTTCCGTTTCTTGCAGCACTCGTGGGCTAAC
AACCCTGGGTTCATCTTCAACAAGGATGTGGACCCGGGACACGACCCCATCATTGGTGCCAATGCCGGCGCGCCGCGCACCATGCAGGGCTTCAACGCAGCTGATACGACCCAGTCTCTC
GCTCTTCCTGTCGACTGGGTCGTCAGCCGCGGCGGGGAGTACTTCTTCGCCCCGAGCATCTCCTCGATCAAGAACTTCATTTCCGTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGACGGGAGGCTCAGAAATCCCTGGTTTAGTCCCGTTCCCTAAAGCTGCTGCGAATGACGCCGCGTTGCCATTCAATGATATTCAGGGCGACATCCTGGCAGGGATGAAGAAGAAC
AAGCAAGCGTTCTACTTCTTCTCCATTCAGAACCCGAAGAAGTTCAAAGTGGTTCTGCATACGCTCATCGCGCCGTTCCTCACGTCCACGAAGCAGCTCATGAATGTCACAAACC
AGCCT
ATCGTCGCACTTAATCTCGCGTTCAGCCAATCGGGTTTGACGGCCCTGGGCATCACGGACAACCTCGGGGATCCAGAGTTCACTGCAGGCCAGTTCGCCGATGCGGAATTCCTCGGCGAC
CCCGGCACGGGTAACTGGAAGCCTGCGTTCCGCGGAACAAAGATCCACGGCGTCTTCCTCATGGCAAGCGACAAGCAGCCCTTCATCGACCTCATGGTCCTCCTCGTCCGCGGTCTTTTC
TTCAACATCATCAACGAGGAGTACATCCTGAACGGCAACGTTCGGCCGGGTGCTGAGGCCGGACACGAGA
TGTTTGGCTACCTGGACGGCATCGCCCAGCCCAGCATTCCGGCATTCCAG
GCGCCATTCCCGGGCCAGCAGGTCATTGACCCTGGCGTGCTCCTCCTCAACACGACCGGCGATCCCATTCCCCGCCCTGCCTGGACCAAGTTCGGCTCCTTCCTTGCGTTCCGCCAGCTG
CAACAGCTCGTTCCCGAGTTTGATGGCTTCGTGAAGGCCTCCGCGCCGACAATCCCGGGTCTCACAACCGGCCAGAGTGCTGATCTCCTCGGAGCGCGCAT
GATCGGACGCTGGAAAAGC
GGCGCACCAGTCGATCTGTTCCCGCTCACTGACGGCGGATCCGCTGTTGGCAACGACCCGTTCCAGAACAACAACTTCGACTTCCAGCACGCCGGCTTCAACTTCACGACGGACCAGACG
CACTGCCCCTTTGACGCGCACATTCG
TAAAACCCGTCCCCGCGCCGATCTCGTCGCCCCCGCTAACTCCATCATGCGCTCAGGCATCCCGTATGGCCCAGAAGTCACTGCCGCTGAGAAG
GCTGCCGGGCGCTCGGACCCTGCAGATGGTCCGCGCGAGCGCGGCCTTGCGTTTGTTTCCTACCAG
GCTCAGATCGCTAAGGGCTTCCGTTTCTTGCAGCACTCGTGGGCTAACAACCCT
GGGTTCATCTTCAACAAGGATGTGGACCCGGGACACGACCCCATCATTGGTGCCAATGCCGGCGCGCCGCGCACCATGCAGGGCTTCAACGCAGCTGATACGACCCAGTCTCTCGCTCTT
CCTGTCGACTGGGTCGTCAGCCGCGGCGGGGAGTACTTCTTCGCCCCGAGCATCTCCTCGATCAAGAACTTCATTTCCGTTTAA

Retrieve as FASTA