Entry information : AdelDyPrx06 (DyP6)
Entry ID 9908
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: AdelDyPrx06 (DyP6)
Name (synonym) AdelDyPrx06 (DyP6)
Class DyP-type peroxidase D    [Orthogroup: DyPrxD002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelDyPrx06
start..stop
S start..stop
AdelDyPrx03 711 0 74..531 2..454
AdelDyPrx09 626 0 1..515 1..536
AdelDyPrx04 611 0 21..515 5..472
AdelDyPrx05 597 0 27..515 28..511
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18118..18241 124 N° 2 17982..18066 85 N° 3 17459..17922 464 N° 4 17291..17404 114
N° 5 17039..17232 194 N° 6 16928..16987 60 N° 7 16782..16864 83 N° 8 16644..16735 92
N° 9 16308..16586 279 N° 10 16160..16260 101  
complement(join(16160..16260,16308..16586,16644..16735,16782..16864,16928..16987 ,17039..17232,17291..17404,17459..17922,17982..18066,18118..18241))


exon

Literature and cross-references AdelDyPrx06 (DyP6)
DNA ref. JGI genome:   scaffold_111 (18241..16160)
Protein sequence: AdelDyPrx06 (DyP6)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   531
PWM (Da):   %s   56969.39  
PI (pH):   %s   5.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLPTVPTGALPGQFVANAGPVHSTENPAATTGVRQTSLYNCIDGLPPVPSADDVAGSELKTDDIQSDIFVGKQKHNQLFYFFTIHDAASFKRHLAADIAPIVTSVTQIPHVHRQPLVAVNIAFSHAGLLALDVNYEDNSLNDEIFENGQAASAVTSLNDDTASWVPQFKDAENPIHGVIILASDNIQLIDRQVACIQSDCGPSISKVYSLPAAVRPGCHAGHMFGFLDGIAQPSIRQLHKTHFPGQNVVDAGVIITGAVGDVDGEGNPIKRADWAVGGSFLAFRQLQQLVPEFNRYLLQNAPAGEGDLQSRADLMGARMVGRWKGAPVDLAPTADDPELGADPQRNNNFTYEHEGSDLRSDQSRCPFTAHIRKTRPRADLTSIGFDDKPNSIMRAGIPYGQVTPEEQASGTTIHERGLAFVAYQSQLAKGFQFIQQSWANATNFPPKKTPPPEEIGFDPIIGQATGAQARLVSGLDPNDTSGSLSIPQFVISRGGEYFFSPPISALRGHLAGIDDGDHEHLGRHHCH

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCCCCACAGTGCCCACTGGTGCTCTCCCCGGCCAGTTTGTCGCAAACGCTGGTCCGGTGCACTCCACGGAGAACCCAGCAGCCACGACCGGCGTGCGGCAGACTAGTCTGTAC
AACT
GTGAGTAATCGTCCTTACTAAAAGCATGGGTATGCCTGATGGTCCTTATAGGTATCGATGGTCTTCCTCCCGTGCCGTCCGCGGACGACGTAGCCGGCTCAGAGCTGAAGACAGAC
GACATTCAATCCGATATCTT
GTCAGTCAACTCACATATGACCACGCCGTCCGGAGGCTTCATGCTGACAAAAATCGCAGCGTCGGAAAGCAGAAGCACAACCAGCTTTTTTACTTCTTCA
CCATCCATGACGCTGCGAGCTTCAAGCGCCATCTCGCCGCGGACATTGCGCCCATCGTCACATCCGTCACACAGATCCCGCACGTTCACAGGCAGCCGCTCGTTGCTGTTAACATCGCCT
TCTCGCACGCTGGACTGCTCGCCCTGGACGTCAACTACGAGGACAATAGCCTCAACGACGAAATCTTCGAGAACGGCCAGGCCGCTAGTGCCGTCACGAGTCTAAACGATGACACTGCGT
CGTGGGTGCCGCAGTTTAAGGATGCTGAGAACCCAATCCACGGCGTCATCATCCTGGCAAGCGACAACATCCAGCTCATCGACCGGCAGGTAGCCTGCATTCAGTCCGACTGCGGCCCTT
CGATCTCGAAGGTATACTCGCTGCCGGCTGCTGTCCGCCCGGGTTGCCATGCTGGGCATGAGA
GTCAGTACTTAGATGTTCATCATCGACATCTCGTTCTGACTCAACCGCTCTCAGTGT
TCGGATTCCTGGACGGAATCGCTCAGCCATCCATTCGCCAACTTCACAAGACGCATTTCCCTGGCCAGAACGTAGTTGATGCCGGCGTTATCATCACAGGCGCTGTCGGAG
GTGAGTGGT
GGGAGGAAACGAAATATGTCCGGATGGCTGAGAGTCCTTACACTGGCAGACGTCGACGGAGAAGGAAACCCCATCAAACGCGCAGACTGGGCCGTCGGAGGGTCCTTCCTCGCGTTTCGC
CAGCTCCAGCAACTCGTGCCGGAGTTCAACCGGTACCTCCTGCAGAACGCTCCAGCCGGGGAAGGCGACCTACAGTCGCGCGCCGATCTCATGGGAGCGCGCATGGTCGGGCGTTGGAAG
TCG
GTTCGTATGCGCCAGTTCAACTGGAATGACGACGCTGACCGGGATTCGTAGGGCGCGCCTGTGGACCTCGCGCCGACCGCGGACGACCCAGAACTCGGAGCTGACCCCCAGGTCTGC
CAGCTGATTCAGCTGCATCTGCGACTTCAGTATTGAATTAAGTACATTCGATTGCAGCGCAACAACAACTTCACGTATGAACACGAGGGCTCAGATCTGCGAAGCGACCAGAGCCGCTGC
CCGTTCACGGCGCATATCAG
GTCTGTTCTGGGATACGTTGCTGTGTCCATGCTGATGTCATTACAGGAAGACTCGCCCTCGCGCGGACTTGACGTCTATCGGCTTCGATGACAAGCCTAA
CTCTATCATGAGAGCCGGCATCCCATATGGACAGGAAG
GTGGGCTGCTTCACCAGTCCCAGGTTCACAGGGCGTCTCACAAGGACCTATTGTCAGTGACCCCCGAGGAACAAGCGTCTGG
TACTACAATTCACGAGCGAGGCCTTGCGTTCGTTGCGTATCAGTCCCAACTGGCCAAGGGCTTTCAGTTCATTCAGCAGTCTTGGGCGAACGCTACGAACTTCCCTCCCAAGAAGACGCC
GCCGCCGGAGGAAATTGGTTTCGATCCTATCATCGGGCAGGCGACTGGCGCACAGGCCCGTCTTGTCAGCGGGTTGGACCCCAACGACACCAGCGGCTCGCTCAGCATCCCCCAGTTTGT
TATCAGCCGTGGCG
GTGAGTACACAGCCTTCGTACTCGAGTACAAACTTATGTGGTCGTAGGGGAATACTTCTTCTCTCCTCCCATCTCTGCTCTCAGGGGCCACCTCGCGGGTATCGAC
GACGGTGATCACGAACACCTGGGCCGTCATCACTGCCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCCCCACAGTGCCCACTGGTGCTCTCCCCGGCCAGTTTGTCGCAAACGCTGGTCCGGTGCACTCCACGGAGAACCCAGCAGCCACGACCGGCGTGCGGCAGACTAGTCTGTAC
AACT
GTATCGATGGTCTTCCTCCCGTGCCGTCCGCGGACGACGTAGCCGGCTCAGAGCTGAAGACAGACGACATTCAATCCGATATCTTCGTCGGAAAGCAGAAGCACAACCAGCTTTTT
TACTTCTTCACCATCCATGACGCTGCGAGCTTCAAGCGCCATCTCGCCGCGGACATTGCGCCCATCGTCACATCCGTCACACAGATCCCGCACGTTCACAGGCAGCCGCTCGTTGCTGTT
AACATCGCCTTCTCGCACGCTGGACTGCTCGCCCTGGACGTCAACTACGAGGACAATAGCCTCAACGACGAAATCTTCGAGAACGGCCAGGCCGCTAGTGCCGTCACGAGTCTAAACGAT
GACACTGCGTCGTGGGTGCCGCAGTTTAAGGATGCTGAGAACCCAATCCACGGCGTCATCATCCTGGCAAGCGACAACATCCAGCTCATCGACCGGCAGGTAGCCTGCATTCAGTCCGAC
TGCGGCCCTTCGATCTCGAAGGTATACTCGCTGCCGGCTGCTGTCCGCCCGGGTTGCCATGCTGGGCATGAGA
TGTTCGGATTCCTGGACGGAATCGCTCAGCCATCCATTCGCCAACTT
CACAAGACGCATTTCCCTGGCCAGAACGTAGTTGATGCCGGCGTTATCATCACAGGCGCTGTCGGAG
ACGTCGACGGAGAAGGAAACCCCATCAAACGCGCAGACTGGGCCGTCGGAGGG
TCCTTCCTCGCGTTTCGCCAGCTCCAGCAACTCGTGCCGGAGTTCAACCGGTACCTCCTGCAGAACGCTCCAGCCGGGGAAGGCGACCTACAGTCGCGCGCCGATCTCATGGGAGCGCGC
ATGGTCGGGCGTTGGAAGTCG
GGCGCGCCTGTGGACCTCGCGCCGACCGCGGACGACCCAGAACTCGGAGCTGACCCCCAGCGCAACAACAACTTCACGTATGAACACGAGGGCTCAGAT
CTGCGAAGCGACCAGAGCCGCTGCCCGTTCACGGCGCATATCAG
GAAGACTCGCCCTCGCGCGGACTTGACGTCTATCGGCTTCGATGACAAGCCTAACTCTATCATGAGAGCCGGCATC
CCATATGGACAGGAAG
TGACCCCCGAGGAACAAGCGTCTGGTACTACAATTCACGAGCGAGGCCTTGCGTTCGTTGCGTATCAGTCCCAACTGGCCAAGGGCTTTCAGTTCATTCAGCAG
TCTTGGGCGAACGCTACGAACTTCCCTCCCAAGAAGACGCCGCCGCCGGAGGAAATTGGTTTCGATCCTATCATCGGGCAGGCGACTGGCGCACAGGCCCGTCTTGTCAGCGGGTTGGAC
CCCAACGACACCAGCGGCTCGCTCAGCATCCCCCAGTTTGTTATCAGCCGTGGCG
GGGAATACTTCTTCTCTCCTCCCATCTCTGCTCTCAGGGGCCACCTCGCGGGTATCGACGACGGT
GATCACGAACACCTGGGCCGTCATCACTGCCACTGA

Retrieve as FASTA