Entry information : AdelGPx
Entry ID 9911
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: AdelGPx
Name AdelGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelGPx
start..stop
S start..stop
AsubGPx01 342 3e-123 1..165 1..165
TcamGPx 237 7e-82 3..160 2..159
NlepGPx01 239 8e-82 1..160 57..216
BaGPx01 236 2e-80 3..160 56..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 119442..119551 110 N° 2 119602..119624 23 N° 3 119677..119744 68 N° 4 119801..119842 42
N° 5 119911..119985 75 N° 6 120040..120128 89 N° 7 120177..120264 88  
join(119442..119551,119602..119624,119677..119744,119801..119842,119911..119985, 120040..120128,120177..120264)


exon

Literature and cross-references AdelGPx
DNA ref. JGI genome:   scaffold_16 (119442..120264)
Protein sequence: AdelGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   165
PWM (Da):   %s   18386.41  
PI (pH):   %s   6.93
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKFYTFKADMPGGKTLEFKDLQGKVVLVVNVASKCGLTPQYGLQSLYNKYHDKGLEIVGFPCNFGGQEPGTDAEIAEFCDTNYKVSFPLMKKVDVNGENAHEIYKWLKHEQPGILNIEAIKWNFEKFLLDQNGKIVHRYAPTTGPDAIENEIAKLLGVPK

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGAAGTTCTACACGTTCAAGGCCGACATGCCTGGCGGCAAAACGCTCGAATTCAAGGATCTGCAGGGCAAGGTCGTTCTCGTCGTTAACGTTGCGTCCAAATGGTATTATCGC
GCTCCTATTTCCTTACACATCGATGACTGACCCTCTTTAGTGGCCTTACGCCCCAGTACAAGGGTGCGCCTGGCAGGCGACGCCATGCATCCATATGAGCTCAACACCCGCGCAGGCCTG
CAGTCCTTGTACAACAAGTACCACGACAAGGGCCTCGAGATAGTCGGCTTCCCGTGCAACCAG
GTGCGCATCCGCAGCCTGCTGCGGCCTGTGCGCTAGGCGCTGACTGGCGGTGACAGT
TTGGAGGGCAAGAGCCGGGCACAGATGCCGAAATCGCGGAG
GTCAGTGGCGCGCGCGCGTGTCTCGCCTTGAATGTGCAAGTCTAATCCTTGATGCCGGCTACTGTCAGTTCTGCGACAC
CAACTACAAAGTATCGTTCCCGCTCATGAAGAAGGTCGACGTCAACGGCGAGAATGCGCACGAG
GTGCGTGGCCCACCTTGCGCACCCGCCTGCAACAGCAGTCTTAACGCCCCACAGAT
CTACAAGTGGTTGAAGCACGAGCAGCCCGGCATTCTGAACATCGAGGCCATCAAGTGGAATTTCGAGAAGTTCCTCCTGGACCAGAA
GTGCGTCTACCCTGCAGATTTTCCGCACGACGA
CTGACTGTTTGTCAGCGGCAAGATTGTGCACCGCTACGCGCCCACAACTGGGCCTGACGCGATTGAGAACGAGATCGCAAAGCTCTTGGGCGTCCCCAAGCAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGAAGTTCTACACGTTCAAGGCCGACATGCCTGGCGGCAAAACGCTCGAATTCAAGGATCTGCAGGGCAAGGTCGTTCTCGTCGTTAACGTTGCGTCCAAATGTGGCCTTACG
CCCCAGTACAAGG
GCCTGCAGTCCTTGTACAACAAGTACCACGACAAGGGCCTCGAGATAGTCGGCTTCCCGTGCAACCAGTTTGGAGGGCAAGAGCCGGGCACAGATGCCGAAATCGCG
GAG
TTCTGCGACACCAACTACAAAGTATCGTTCCCGCTCATGAAGAAGGTCGACGTCAACGGCGAGAATGCGCACGAGATCTACAAGTGGTTGAAGCACGAGCAGCCCGGCATTCTGAAC
ATCGAGGCCATCAAGTGGAATTTCGAGAAGTTCCTCCTGGACCAGAA
CGGCAAGATTGTGCACCGCTACGCGCCCACAACTGGGCCTGACGCGATTGAGAACGAGATCGCAAAGCTCTTG
GGCGTCCCCAAGCAG

Retrieve as FASTA