Entry information : HsubDyPrx02
Entry ID 9913
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2012-03-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-05 (Christophe Dunand)
Peroxidase information: HsubDyPrx02
Name HsubDyPrx02
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Strophariaceae Hypholoma
Organism Hypholoma sublateritium    [TaxId: 71945 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsubDyPrx02
start..stop
S start..stop
HsubDyPrx01 714 0 1..489 1..491
HcyDyPrx02 694 0 1..489 1..486
GmarDyPrx01 678 0 1..487 1..484
LbiDyPrx01 603 0 1..487 18..500
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46962..47020 59 N° 2 46686..46905 220 N° 3 46284..46606 323 N° 4 45917..46221 305
N° 5 45791..45851 61 N° 6 45446..45726 281 N° 7 45327..45381 55 N° 8 45097..45262 166
complement(join(45097..45262,45327..45381,45446..45726,45791..45851,45917..46221 ,46284..46606,46686..46905,46962..47020))


exon

Literature and cross-references HsubDyPrx02
DNA ref. JGI genome:   scaffold_101 (47020..45097)
Protein sequence: HsubDyPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   489
PWM (Da):   %s   52757.25  
PI (pH):   %s   6.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATPPTPPEFNLDNIQGDILSGLPKKTETYIVFSITNATKFRKDLHNLIPLIKTVSGVLKDRQAIDDHKKKKLPGLVPMTGVNISFSHLGFTLGIDDTTLRPVNPKTGAVNPFELGQKVDAVTNLGDTQKLNGDPDWDEAFLQGNIHGLIIISGDSHLSVNAVRLKIEAIFGVRTPTASLKEVISIVGDVRPGAEAGHEHFGFLDGISNPVVTGFDTVINPGPKPVNPGVIVTGHNGDTTTRADWATDGSFLAFRYLFQEVPEFNVFLSKNPIPKDGNGVALTPADGSELLGARMVGRWKGAPIDVSPFKDDPALAADATRNNDFFFAGEINSQLKCPFAAHVRKTNPRDDLEVPPTGITPIPVEGNRIMRRGVQFGPELTPQEKATGVTAHGRGLLFACYQTNLFNGFQFLQTWANNADFQPFETQPEKPGLDPLIGQGVRSMSGLDPLNEQKLLSMPQFIIPRGGEYFFAPSINGLKTTIATAT

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACACCCCCAACCCCTCCAGAGTTCAACCTTGACAACATCCAAGGCGATATCTTGTACGCAAAATAAAGCTTTCTTGCCGCAGATATATTTTAATAACGCCCCCCTGCAGGAGCG
GCCTTCCCAAGAAGACGGAGACCTACATCGTCTTCAGTATCACCAATGCCACGAAGTTCAGGAAAGACCTGCACAACCTCATACCGCTCATCAAGACCGTCTCCGGCGTCCTCAAGGACC
GCCAGGCGATCGACGACCACAAGAAGAAGAAGCTTCCGGGCCTTGTCCCGATGACGGGCGTTAACATCTCTTTCTCGCACCTCGGGTTCACCACG
GTCAGCGGGCGTCTAATATTTCGCG
GTGGCAATTGTGTGCTCACGCGTACTATTTATTTTGTTTTACTTCTGCCGACAGCTTGGAATCGACGACACTACCCTGCGCCCCGTTAACCCAAAGACTGGCGCAGTCAACCCATTCGAG
CTTGGGCAGAAGGTGGACGCGGTGACGAACCTCGGCGACACGCAGAAGCTCAACGGCGACCCGGACTGGGACGAGGCGTTCTTGCAGGGCAATATCCATGGGCTCATCATCATATCAGGC
GACAGCCACCTCTCCGTTAACGCGGTCCGGCTCAAGATCGAGGCTATCTTCGGCGTGCGCACGCCGACGGCCTCGCTGAAGGAGGTAATCAGCATCGTGGGCGACGTGCGGCCGGGCGCA
GAGGCAGGGCACGAGCA
GTGAGCTGCATTTACCTGTCGAGGTACTTAATACCGCAACTGACAATTTTTCTCTACACTAGCTTTGGATTCCTGGACGGCATCTCCAACCCTGTCGTGACTG
GATTCGACACCGTCATCAACCCCGGCCCCAAGCCCGTTAATCCCGGCGTCATCGTCACAGGCCACAATGGAGACACCACAACGCGCGCAGACTGGGCGACAGACGGTAGCTTCCTCGCTT
TTAGGTACCTATTCCAGGAGGTGCCCGAGTTCAATGTGTTCCTCTCGAAGAATCCCATCCCCAAGGACGGGAATGGTGTCGCACTTACGCCCGCTGACGGGAGCGAGCTCCTCGGAGCGC
GGATGGTCGGGCGCTGGAAGAGCG
GTGCGTTGCATACTTACAGCGCCCATTTCACTTCAGCGCGGTGTGCTGATTCTTAAATATAATAGGAGCGCCGATTGATGTCTCGCCGTTTAAGGA
CGATCCCGCCCTCGCCGCTGATGCCACGAG
GTCAGAATAAGCGCCCACATTCACTCTTCACATTGCTCACTGGCAATCTATTTTCATTTTGCAGGAACAACGACTTCTTCTTTGCCGGAG
AAATCAACTCGCAGCTCAAGTGCCCCTTCGCCGCGCACGTCCGCAAGACGAACCCGCGCGACGACCTCGAAGTGCCGCCGACCGGCATCACGCCGATCCCGGTCGAGGGTAACCGCATCA
TGCGGCGCGGGGTGCAGTTTGGGCCGGAGCTGACCCCGCAGGAGAAGGCGACGGGGGTGACGGCGCACGGGCGCGGGCTGCTCTTCGCGTGCTACCAGACGAATCTCTTCAACGGGTTCC
AGTTCCTCCAACAGA
GTGAGTAATGGCGCACCTCCGGATTTAACTATGACTACATTCTGATCCTTATCTAACTTGAAAGCTTGGGCGAATAATGCGGATTTCCAACCGTTCGAGACTCAA
CCTGAGAAGCCTGG
GTGAGTAGTTTTATTCGTCCCGGATGAATCTGCACTGTATTAACGTTGCGCGCGTATTGATTAGATTGGACCCGCTCATTGGCCAAGGCGTGCGCTCGATGTCGGG
ACTTGATCCTTTGAACGAGCAAAAGCTTTTGTCGATGCCTCAGTTCATCATCCCCCGTGGCGGAGAATACTTTTTCGCGCCTTCCATTAATGGGTTGAAGACAACCATTGCGACAGCCAC
TTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACACCCCCAACCCCTCCAGAGTTCAACCTTGACAACATCCAAGGCGATATCTTGAGCGGCCTTCCCAAGAAGACGGAGACCTACATCGTCTTCAGTATCACCAATGCCACGAAG
TTCAGGAAAGACCTGCACAACCTCATACCGCTCATCAAGACCGTCTCCGGCGTCCTCAAGGACCGCCAGGCGATCGACGACCACAAGAAGAAGAAGCTTCCGGGCCTTGTCCCGATGACG
GGCGTTAACATCTCTTTCTCGCACCTCGGGTTCACCACG
CTTGGAATCGACGACACTACCCTGCGCCCCGTTAACCCAAAGACTGGCGCAGTCAACCCATTCGAGCTTGGGCAGAAGGTG
GACGCGGTGACGAACCTCGGCGACACGCAGAAGCTCAACGGCGACCCGGACTGGGACGAGGCGTTCTTGCAGGGCAATATCCATGGGCTCATCATCATATCAGGCGACAGCCACCTCTCC
GTTAACGCGGTCCGGCTCAAGATCGAGGCTATCTTCGGCGTGCGCACGCCGACGGCCTCGCTGAAGGAGGTAATCAGCATCGTGGGCGACGTGCGGCCGGGCGCAGAGGCAGGGCACGAG
CA
CTTTGGATTCCTGGACGGCATCTCCAACCCTGTCGTGACTGGATTCGACACCGTCATCAACCCCGGCCCCAAGCCCGTTAATCCCGGCGTCATCGTCACAGGCCACAATGGAGACACC
ACAACGCGCGCAGACTGGGCGACAGACGGTAGCTTCCTCGCTTTTAGGTACCTATTCCAGGAGGTGCCCGAGTTCAATGTGTTCCTCTCGAAGAATCCCATCCCCAAGGACGGGAATGGT
GTCGCACTTACGCCCGCTGACGGGAGCGAGCTCCTCGGAGCGCGGATGGTCGGGCGCTGGAAGAGCG
GAGCGCCGATTGATGTCTCGCCGTTTAAGGACGATCCCGCCCTCGCCGCTGAT
GCCACGAG
GAACAACGACTTCTTCTTTGCCGGAGAAATCAACTCGCAGCTCAAGTGCCCCTTCGCCGCGCACGTCCGCAAGACGAACCCGCGCGACGACCTCGAAGTGCCGCCGACCGGC
ATCACGCCGATCCCGGTCGAGGGTAACCGCATCATGCGGCGCGGGGTGCAGTTTGGGCCGGAGCTGACCCCGCAGGAGAAGGCGACGGGGGTGACGGCGCACGGGCGCGGGCTGCTCTTC
GCGTGCTACCAGACGAATCTCTTCAACGGGTTCCAGTTCCTCCAACAGA
CTTGGGCGAATAATGCGGATTTCCAACCGTTCGAGACTCAACCTGAGAAGCCTGGATTGGACCCGCTCATT
GGCCAAGGCGTGCGCTCGATGTCGGGACTTGATCCTTTGAACGAGCAAAAGCTTTTGTCGATGCCTCAGTTCATCATCCCCCGTGGCGGAGAATACTTTTTCGCGCCTTCCATTAATGGG
TTGAAGACAACCATTGCGACAGCCACTTGA

Retrieve as FASTA