Entry information : VdaGPx01
Entry ID 9918
Creation 2011-12-07 (Passaia Gisèle)
Last sequence changes 2011-12-07 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-20 (Christophe Dunand)
Peroxidase information: VdaGPx01
Name VdaGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Verticillium
Organism Verticillium dahliae    [TaxId: 27337 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VdaGPx01
start..stop
S start..stop
VaaGPx01 468 4e-170 1..236 1..235
CgraGPx01 319 1e-111 66..236 63..233
CfioGPx01_MH18 319 2e-111 66..238 68..240
ChigGPx01 318 6e-111 66..238 67..239
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 617326..617581 256 N° 2 617640..618136 497  
join(617326..617581,617640..618136)


exon

Literature and cross-references VdaGPx01
DNA ref. JGI genome:   Supercontig_1.20 (617326..618136)
Protein sequence: VdaGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   28104.37  
PI (pH):   %s   9.89
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTCPRFASQHFRQLAYRPRLDHKSVGTLARLKTCSLQQQHQPYHIQQRRPTNIPVTWRYTPPSDSIRTRTTMASATSFYDFKPLDKRGQEAPTADYKGKVVLIVNTASKCGFTPQFEGLEKLYKSVKEKHGDDFVILGFPCNQFASQDPGTDDDIQSFCQLNYGVTFPIMAKSDVNGDAANPLFTWLKDEKPGIMGLKRIKWNFEKFLVGRDGKVKGRWASTTKPEALEKPVLDELAKPAPADAAPAAKP

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron) and 1 EST. Strain="VaMs.102".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATGTCCTAGGTTCGCGTCGCAGCATTTTCGCCAGCTCGCATATAGACCCCGCCTTGATCACAAATCTGTTGGCACCCTCGCTCGTTTGAAAACTTGCTCCTTACAACAACAACAC
CAACCGTACCACATACAACAGCGTCGCCCGACAAATATACCTGTGACCTGGAGATATACCCCGCCTTCCGACTCAATACGAACACGAACAACCATGGCGTCCGCTACCAGCTTCTACGAC
TTCAAGCCGCTCGACA
GTATGTGTCTGATCCCCATGCGCGCTCCAATTAAACTGTCCACTAACACATGGATCAGAGCGTGGCCAGGAGGCCCCCACCGCCGATTACAAGGGCAAGGTCGT
CCTCATTGTCAACACGGCCTCCAAGTGCGGTTTCACACCGCAATTCGAGGGCCTCGAGAAGCTCTACAAGTCCGTCAAGGAGAAGCACGGCGATGACTTTGTCATCCTCGGCTTCCCCTG
CAACCAGTTCGCCAGCCAGGACCCCGGTACCGACGACGACATCCAGAGCTTCTGCCAGCTCAACTACGGTGTCACCTTCCCCATCATGGCCAAGTCCGACGTCAACGGCGACGCGGCCAA
CCCCCTCTTCACCTGGCTCAAGGACGAGAAGCCCGGTATCATGGGCCTCAAGCGCATCAAGTGGAACTTTGAGAAGTTCCTCGTCGGTCGCGATGGCAAGGTCAAGGGACGCTGGGCCAG
CACCACCAAGCCCGAGGCTCTTGAGAAACCCGTGCTCGACGAGCTCGCCAAGCCCGCGCCCGCCGATGCTGCTCCTGCTGCCAAGCCTGAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATGTCCTAGGTTCGCGTCGCAGCATTTTCGCCAGCTCGCATATAGACCCCGCCTTGATCACAAATCTGTTGGCACCCTCGCTCGTTTGAAAACTTGCTCCTTACAACAACAACAC
CAACCGTACCACATACAACAGCGTCGCCCGACAAATATACCTGTGACCTGGAGATATACCCCGCCTTCCGACTCAATACGAACACGAACAACCATGGCGTCCGCTACCAGCTTCTACGAC
TTCAAGCCGCTCGACA
AGCGTGGCCAGGAGGCCCCCACCGCCGATTACAAGGGCAAGGTCGTCCTCATTGTCAACACGGCCTCCAAGTGCGGTTTCACACCGCAATTCGAGGGCCTCGAG
AAGCTCTACAAGTCCGTCAAGGAGAAGCACGGCGATGACTTTGTCATCCTCGGCTTCCCCTGCAACCAGTTCGCCAGCCAGGACCCCGGTACCGACGACGACATCCAGAGCTTCTGCCAG
CTCAACTACGGTGTCACCTTCCCCATCATGGCCAAGTCCGACGTCAACGGCGACGCGGCCAACCCCCTCTTCACCTGGCTCAAGGACGAGAAGCCCGGTATCATGGGCCTCAAGCGCATC
AAGTGGAACTTTGAGAAGTTCCTCGTCGGTCGCGATGGCAAGGTCAAGGGACGCTGGGCCAGCACCACCAAGCCCGAGGCTCTTGAGAAACCCGTGCTCGACGAGCTCGCCAAGCCCGCG
CCCGCCGATGCTGCTCCTGCTGCCAAGCCTGAG

Retrieve as FASTA