Entry information : Pcar1CysPrx01
Entry ID 9919
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-12-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: Pcar1CysPrx01
Name Pcar1CysPrx01
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pcar1CysPrx01
start..stop
S start..stop
Pc1CysPrx01 406 1e-146 1..222 1..222
Ab1CysPrx_bisporus 384 8e-138 1..221 1..221
Hcy1CysPrx 377 5e-135 1..222 1..222
Athi1CysPrx01 373 1e-133 1..222 1..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2783850..2783945 96 N° 2 2783723..2783793 71 N° 3 2783535..2783670 136 N° 4 2783390..2783482 93
N° 5 2783227..2783332 106 N° 6 2783038..2783168 131 N° 7 2782942..2782977 36  
complement(join(2782942..2782977,2783038..2783168,2783227..2783332,2783390..2783 482,2783535..2783670,2783723..2783793,2783850..2783945))


exon

Literature and cross-references Pcar1CysPrx01
DNA ref. JGI genome:   scaffold_2 (2783945..2782942)
Cluster/Prediction ref. JGI gene:   170200
Protein sequence: Pcar1CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   222
PWM (Da):   %s   24859.83  
PI (pH):   %s   6.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSLRLGNTAPDFEAETTQGPIKFHNWIGNHWAILFSHPGDFTPVCTTELAEVARLKPDFEKRGVKLIGISANGLEDHYKWAKDIEEWGAQFGPTTVDFPIADADRKIATLYDMLDEQDPTNVDAKGLPFTIRTVFIIDPKKTIRLMLAYPASTGRNFDEIIRVTDSLQIGDKHRVTTPANWKKGDDVIVHPSVSTEEAKTLFPEHTVHPYLRTTPLKVD*

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTCTCCGTCTTGGAAACACAGCCCCCGACTTTGAAGCCGAGACGACCCAGGGACCCATCAAGTTCCATAACTGGATCGGCAACCATTGGGTACGCAGTGTGCCGTGCATTTTC
GCGTGTTATCGTTGAACGCGGGGTATTCGCAGGCCATCCTGTTCTCCCATCCCGGCGACTTCACGCCTGTCTGCACGACTGAGCTTGCCGAGGTGGCGCGCCTGTATGTTCACGTTAGAC
ATGCTTGCAGCTCGAGATGTTAATGAATGATGTAGCAAACCTGACTTTGAGAAGCGAGGTGTGAAGCTGATCGGGATCTCCGCTAACGGACTCGAGGACCACTACAAGTGGGCGAAGGAC
ATTGAAGAGTGGGGTGCGCAATTTGGGCCAACGACTGTTGATTTCCCTATC
GTACGTCCATACTCAGGGCTATCAACTAATTGTGTGCTGAAGAGCCGGCCAGATTGCGGATGCGGATCG
CAAGATTGCCACGCTTTACGACATGCTTGACGAGCAGGATCCGACCAATGTTGATGCAAAGGGGCTTCCCTTCACC
GTATGTTTACTTCGCATGGTGTCCAGGTCTGACTATAGACAATA
ACGATCCCATCAGATCCGCACTGTCTTCATCATCGACCCCAAGAAGACCATCCGTCTGATGCTTGCCTACCCTGCATCGACTGGACGCAACTTCGACGAGATCATTCGTGTTACTGACTG
TGCGTACATTGCAAGGCAGCCCTACCAGAATTTCACACGTACTAACAATCGCTGCAGCTCTCCAGATTGGCGACAAGCACCGTGTTACAACGCCCGCCAACTGGAAGAAGGGCGACGACG
TTATCGTCCATCCGTCTGTTAGCACCGAGGAGGCGAAGACTCTGTTCCCCGAGCACACCGTTCACAAG
GCATGTGTTCGCTGTCGGCCTTGCGTACGGTCGGGTACTGACATCCAACACT
CTTTGCAGCCTTACCTCAGGACCACCCCGCTCAAGGTTGATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTCTCCGTCTTGGAAACACAGCCCCCGACTTTGAAGCCGAGACGACCCAGGGACCCATCAAGTTCCATAACTGGATCGGCAACCATTGGGCCATCCTGTTCTCCCATCCCGGC
GACTTCACGCCTGTCTGCACGACTGAGCTTGCCGAGGTGGCGCGCCT
CAAACCTGACTTTGAGAAGCGAGGTGTGAAGCTGATCGGGATCTCCGCTAACGGACTCGAGGACCACTACAAG
TGGGCGAAGGACATTGAAGAGTGGGGTGCGCAATTTGGGCCAACGACTGTTGATTTCCCTATC
ATTGCGGATGCGGATCGCAAGATTGCCACGCTTTACGACATGCTTGACGAGCAGGAT
CCGACCAATGTTGATGCAAAGGGGCTTCCCTTCACC
ATCCGCACTGTCTTCATCATCGACCCCAAGAAGACCATCCGTCTGATGCTTGCCTACCCTGCATCGACTGGACGCAACTTCGAC
GAGATCATTCGTGTTACTGACT
CTCTCCAGATTGGCGACAAGCACCGTGTTACAACGCCCGCCAACTGGAAGAAGGGCGACGACGTTATCGTCCATCCGTCTGTTAGCACCGAGGAGGCG
AAGACTCTGTTCCCCGAGCACACCGTTCACAAG
CCTTACCTCAGGACCACCCCGCTCAAGGTTGATTGA

Retrieve as FASTA