Entry information : Pcar1CysPrx02
Entry ID 9920
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-12-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: Pcar1CysPrx02
Name Pcar1CysPrx02
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pcar1CysPrx02
start..stop
S start..stop
Pc1CysPrx02 396 1e-142 4..224 6..226
Pc1CysPrx01 296 4e-103 6..221 4..219
Ccin1CysPrx 293 3e-102 6..221 4..219
Athi1CysPrx01 291 4e-101 6..221 4..219
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1151539..1151640 102 N° 2 1151410..1151480 71 N° 3 1151212..1151347 136 N° 4 1151072..1151164 93
N° 5 1150922..1151016 95 N° 6 1150858..1150868 11 N° 7 1150666..1150796 131 N° 8 1150578..1150613 36
complement(join(1150578..1150613,1150666..1150796,1150858..1150868,1150922..1151 016,1151072..1151164,1151212..1151347,1151410..1151480,1151539..1151640))


exon

Literature and cross-references Pcar1CysPrx02
DNA ref. JGI genome:   scaffold_3 (1151640..1150578)
Protein sequence: Pcar1CysPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   225
PWM (Da):   %s   25456.67  
PI (pH):   %s   4.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESSKLRLGSIAPDFEADTTEGQIRFHEWIGDSWVMFFSHPGDFTPVCTTELADISHRAPQFLERGIKVIGISADALQEHYEWIEDIIEIGNKTAPTCVEYPIADPGRKIAEMYEMFDGEEMTNVSEDGQMNIIRTVFFIDPKKTIRAMVIYPASVGRDFDEIIRVFALQTADKYPIGTPANWQKGDDVIIQPHVSDEEARKLFPEYKTLIPYLRTTPLPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic . Uncorrect prediction from JGI (splicing error intron 4).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTCCTCAAAGCTCCGACTTGGAAGCATCGCCCCGGATTTCGAGGCAGACACCACTGAAGGGCAAATCAGGTTTCACGAATGGATCGGCGACTCTTGGGTACGTCCATGGCGGCGG
AGGATGCGCAGACAGTTTCTGAGTCCTCCCGCGATGGCAGGTCATGTTCTTCTCGCATCCCGGCGACTTCACGCCCGTCTGTACGACGGAGCTCGCTGACATCTCACACCGGTGCGTTTG
GTCGCTCCTGGGGCGTTGTCCCTCCTGTCCTGACAAGCCTACCCCTTGCGCAGGGCACCACAGTTCCTAGAGCGTGGCATCAAGGTTATTGGCATCTCAGCTGACGCGCTCCAGGAGCAC
TACGAATGGATTGAAGACATCATCGAAATAGGGAACAAGACTGCCCCGACATGCGTCGAGTACCCCATT
GTGCGCCCCTATCCCTGGCCACCTCACTTTCCCTAACACCGCCTTAGATTG
CAGATCCGGGCAGGAAGATTGCAGAGATGTATGAGATGTTTGACGGGGAGGAAATGACAAACGTCAGTGAGGATGGACAGATGAATATT
GTAAGCTCGGACACGGTCTCACGCCTGGCCT
CTTCTCCTTCATTCCTCTGCACAGATTCGCACCGTCTTTTTCATCGACCCGAAGAAGACCATCCGTGCGATGGTCATCTACCCTGCGTCTGTTGGCCGCGACTTTGACGAGATCATCAGG
TGCGTCGTGTGCTTTGACTCGAGTCTGGATTGCGCTCACTATCGCGTTCTAGGGTGTTTGACGGTAAGCCGGAGCCGTGCAGACCTCCGAGACCCCATTTTACTACTTGCTTCGCTTGAT
CCAGCTCTCCAGACCGCTGACAAGTACCCGATCGGTACGCCTGCTAACTGGCAGAAAGGCGACGACGTCATTATACAACCGCATGTCTCGGATGAAGAAGCTAGGAAACTCTTTCCGGAA
TATAAGACTTTAATT
GTGCGTAGCCCCCTACCATATTCGACTGTAGCACTCTAAAGTTCGTTTGTAGCCATACCTGCGCACAACGCCATTGCCGCCGTCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTCCTCAAAGCTCCGACTTGGAAGCATCGCCCCGGATTTCGAGGCAGACACCACTGAAGGGCAAATCAGGTTTCACGAATGGATCGGCGACTCTTGGGTCATGTTCTTCTCGCAT
CCCGGCGACTTCACGCCCGTCTGTACGACGGAGCTCGCTGACATCTCACACCG
GGCACCACAGTTCCTAGAGCGTGGCATCAAGGTTATTGGCATCTCAGCTGACGCGCTCCAGGAGCAC
TACGAATGGATTGAAGACATCATCGAAATAGGGAACAAGACTGCCCCGACATGCGTCGAGTACCCCATT
ATTGCAGATCCGGGCAGGAAGATTGCAGAGATGTATGAGATGTTTGACGGG
GAGGAAATGACAAACGTCAGTGAGGATGGACAGATGAATATT
ATTCGCACCGTCTTTTTCATCGACCCGAAGAAGACCATCCGTGCGATGGTCATCTACCCTGCGTCTGTTGGCCGCGAC
TTTGACGAGATCATCAG
GGTGTTTGACGCTCTCCAGACCGCTGACAAGTACCCGATCGGTACGCCTGCTAACTGGCAGAAAGGCGACGACGTCATTATACAACCGCATGTCTCGGATGAA
GAAGCTAGGAAACTCTTTCCGGAATATAAGACTTTAATT
CCATACCTGCGCACAACGCCATTGCCGCCGTCGTAG

Retrieve as FASTA