Entry information : PcarCcP
Entry ID 9921
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-12-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PcarCcP
Name PcarCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarCcP
start..stop
S start..stop
PcCcP 649 0 1..377 1..380
PgigCcP 553 0 1..380 1..386
BaCcP 550 0 1..378 1..386
TcamCcP 532 0 1..374 1..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2644545..2644844 300 N° 2 2644899..2644953 55 N° 3 2645014..2645095 82 N° 4 2645150..2645737 588
N° 5 2645800..2645917 118  
join(2644545..2644844,2644899..2644953,2645014..2645095,2645150..2645737,2645800 ..2645917)


exon

Literature and cross-references PcarCcP
DNA ref. JGI genome:   scaffold_6 (2644545..2645917)
EST ref. GenBank:   HS500033.1 [Fragment]
Protein sequence: PcarCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   380
PWM (Da):   %s   41562.62  
PI (pH):   %s   7.37
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFAALRASLHRAAAPAPAAFRRSAVRSSVRRYSTEPPTPTPAPKSSTALYAGLGAAALGGVAFWVFTSQGDSAKTIAKSGIQGAKAAAKFTPTKEDYIKIYNKVAEVMDEAADKDYDDGSYGPIFLRLGWHSSGTFDKESGTGGSNYATMRFAPESQHGANNGLHVARELMEEIHKEFPWVSYGDLWTLGAVTAIQEMGGPHVPWRPGRIDGVAAQATPDGRLPDGAKGADHLRAVFGRMGFDDREIVALSGGHAVGRCHRDRSGWDGPWTFSPATVSNSFFKLLFDETWVWKKWDGPRQLEDKGTRSLMMLPTDYVLVQDKSFKKWARAYADDEELFFKDFAGVCVKLFENGVPAHQWVTSEPWIMPTTEEQKEAKSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTTGCAGCACTGCGCGCGTCCCTCCACCGGGCTGCTGCCCCCGCCCCTGCCGCTTTCAGGCGCTCTGCCGTTCGCTCGAGCGTGCGCAGGTACTCAACAGAGCCGCCCACCCCC
ACACCCGCTCCCAAGTCGAGTACCGCGCTGTATGCAGGCCTCGGTGCTGCTGCCCTCGGAGGCGTCGCATTCTGGGTCTTCACCTCCCAAGGTGACTCCGCGAAGACTATCGCCAAGTCT
GGCATCCAAGGCGCAAAGGCCGCGGCCAAGTTCACGCCCACAAAGGAGGACTATATTAAG
GTGCGTGCCTCAATGCCGGCGAAAGCTACAGCGAATACTTAGAGGCCTCCAAAGATTTAC
AACAAGGTCGCTGAAGTCATGGATGAGGCTGCTGATAAGGACTACGATG
GTGAGCACCGCGAGGACTTCGTAAGCTGTCTCCGGAGCGCTGATGGTGGCAATGCAACAGACGGATCTTAT
GGCCCTATCTTCCTGCGTCTCGGCTGGCATTCTTCTGGCACTTTCGACAAGGAGTCCGGCACCGGTGGAAG
GTACGCTTTCCTACGTCCGCGCCCCGGAGACCTCAGCTAACCCTTATCT
TGCAGCAACTACGCGACCATGCGGTTTGCGCCCGAGTCCCAGCACGGCGCGAACAACGGCCTGCACGTCGCGCGGGAGCTGATGGAAGAGATCCACAAGGAGTTCCCCTGGGTCTCGTAC
GGCGACCTCTGGACGCTCGGTGCCGTGACGGCCATCCAGGAGATGGGCGGGCCGCACGTGCCATGGCGCCCGGGGCGCATCGACGGCGTCGCGGCGCAGGCGACGCCCGACGGGCGGCTG
CCGGACGGCGCGAAGGGCGCGGACCACCTGCGCGCGGTCTTCGGGCGGATGGGCTTCGACGACCGCGAGATCGTCGCGCTCTCGGGCGGCCACGCCGTCGGGCGCTGCCACCGCGACCGC
TCGGGCTGGGACGGCCCCTGGACGTTCTCGCCCGCGACGGTGAGCAACTCGTTCTTCAAGCTCCTCTTCGACGAGACCTGGGTCTGGAAGAAGTGGGACGGCCCGCGCCAGCTCGAGGAC
AAGGGCACGCGCTCGCTCATGATGCTCCCCACCGACTACGTCCTCGTCCAGGACAAGAGCTTCAAGAAGTGGGCCAGGGCGTACGCAGACGACGAGGAGCTGTTCTTCAAGGA
GTCCGTG
CCGTTTTTCCTCGCCCGAGTATGACGCGTTGTTACTGACTGGATGCAAACTACAGCTTCGCCGGCGTTTGCGTCAAGCTCTTCGAGAACGGTGTCCCCGCCCACCAGTGGGTGACCTCCG
AGCCGTGGATCATGCCAACCACCGAGGAACAGAAGGAGGCCAAGTCTTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTTGCAGCACTGCGCGCGTCCCTCCACCGGGCTGCTGCCCCCGCCCCTGCCGCTTTCAGGCGCTCTGCCGTTCGCTCGAGCGTGCGCAGGTACTCAACAGAGCCGCCCACCCCC
ACACCCGCTCCCAAGTCGAGTACCGCGCTGTATGCAGGCCTCGGTGCTGCTGCCCTCGGAGGCGTCGCATTCTGGGTCTTCACCTCCCAAGGTGACTCCGCGAAGACTATCGCCAAGTCT
GGCATCCAAGGCGCAAAGGCCGCGGCCAAGTTCACGCCCACAAAGGAGGACTATATTAAG
ATTTACAACAAGGTCGCTGAAGTCATGGATGAGGCTGCTGATAAGGACTACGATGACGGA
TCTTATGGCCCTATCTTCCTGCGTCTCGGCTGGCATTCTTCTGGCACTTTCGACAAGGAGTCCGGCACCGGTGGAAG
CAACTACGCGACCATGCGGTTTGCGCCCGAGTCCCAGCACGGC
GCGAACAACGGCCTGCACGTCGCGCGGGAGCTGATGGAAGAGATCCACAAGGAGTTCCCCTGGGTCTCGTACGGCGACCTCTGGACGCTCGGTGCCGTGACGGCCATCCAGGAGATGGGC
GGGCCGCACGTGCCATGGCGCCCGGGGCGCATCGACGGCGTCGCGGCGCAGGCGACGCCCGACGGGCGGCTGCCGGACGGCGCGAAGGGCGCGGACCACCTGCGCGCGGTCTTCGGGCGG
ATGGGCTTCGACGACCGCGAGATCGTCGCGCTCTCGGGCGGCCACGCCGTCGGGCGCTGCCACCGCGACCGCTCGGGCTGGGACGGCCCCTGGACGTTCTCGCCCGCGACGGTGAGCAAC
TCGTTCTTCAAGCTCCTCTTCGACGAGACCTGGGTCTGGAAGAAGTGGGACGGCCCGCGCCAGCTCGAGGACAAGGGCACGCGCTCGCTCATGATGCTCCCCACCGACTACGTCCTCGTC
CAGGACAAGAGCTTCAAGAAGTGGGCCAGGGCGTACGCAGACGACGAGGAGCTGTTCTTCAAGGA
CTTCGCCGGCGTTTGCGTCAAGCTCTTCGAGAACGGTGTCCCCGCCCACCAGTGG
GTGACCTCCGAGCCGTGGATCATGCCAACCACCGAGGAACAGAAGGAGGCCAAGTCTTCTTAA

Retrieve as FASTA