Entry information : ZmPrx97
Entry ID 993
Creation 2008-12-15 (Christophe Dunand)
Last sequence changes 2008-12-15 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx97
Name ZmPrx97
Class Class III peroxidase    [Orthogroup: Prx095]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Roots
Silks
Inducer Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx97
start..stop
S start..stop
ZmPrx09 710 0 1..350 1..350
ZmPrx08 608 0 1..350 1..352
SbPrx37 598 0 1..350 2..365
SbPrx36 585 0 1..349 2..368
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 168807321..168807593 273 N° 2 168807719..168808498 780  
join(168807321..168807593,168807719..168808498)


exon

Literature and cross-references ZmPrx97
Literature Walbot,V., unpublished.
Protein ref. UniProtKB:   B6TSH0 [Mismatch]
DNA ref. GenBank:   AC206295.2 (29639..30804)
mRNA ref. GenBank:   EU967935
Cluster/Prediction ref. UniGene:   Zm.5751 [3' end]
Protein sequence: ZmPrx97
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (330)
PWM (Da):   %s   37530.59 (35494.5)  
PI (pH):   %s   6.65 (6.35) Peptide Signal:   %s   cut: 21 range:21-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTSKLAVLTLFALLGSVSCQSGGYYFYPTPQQPSPTPSPPSSPQLMVGYYKDKCAAYVDVEAIVKKHVKATDAGMQAGLVRLLFHDCFVRGCDGSVLLDTFSNDTSLTPEKFGVPNFPSLRGFEVIDAAKAEIEAACPGTVSCADIVAFAGRDASYFLSGGGINFAMPAGRYDGNVSLANETLPNLPSPFTGFDQLVKVFADKGLDAFDMITLSGAHSIGRSHCSSFTRDRLPPSNTTDIDPAFAATLQASCASPNGTDNTVMQDFKTPDVLDNQYYKNVLAHKVLFTSDAALTTNFTSNNLVRAYADFVPYLWQQKFAKAMVKMAGVEIKTAANGEIRKTCRKVNSRS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, intron 1) and 4 ESTs. Contig contains 6 peroxidases. Cultivar="B73". Also found in AC212733.4.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAACCTCTAAGCTCGCTGTCCTCACTCTGTTTGCCCTGCTCGGCTCCGTGTCATGCCAGTCCGGTGGCTACTACTTCTACCCAACCCCGCAGCAACCATCTCCAACACCCAGCCCT
CCTTCTAGTCCGCAACTCATGGTCGGATACTACAAGGACAAGTGTGCCGCTTACGTGGATGTTGAAGCTATTGTCAAGAAGCACGTCAAGGCCACCGATGCTGGCATGCAGGCCGGGCTT
GTCCGTCTCTTATTCCACGACTGCTTCGTCCGT
GTAAGAGCTCCATAAATCATTCACCAGGCTAGCCATGCCGGCCGTACATTCCATTCAATTCATGCATGCAGTCAGACAGTTAATTAA
TGACGTTGCCATCGCCATGTACGTGGTGGTTTCTGCAGGGATGCGACGGCTCCGTCCTCCTCGACACGTTCAGCAACGACACCAGCCTGACCCCGGAGAAGTTCGGCGTGCCCAACTTCC
CCAGCCTGCGGGGCTTCGAGGTGATCGACGCGGCCAAAGCCGAGATCGAGGCGGCGTGCCCCGGCACGGTCTCGTGCGCGGACATCGTCGCGTTCGCCGGCCGCGATGCGTCCTACTTCC
TCAGCGGCGGCGGCATCAACTTCGCCATGCCCGCGGGGCGCTACGACGGGAACGTCTCCCTCGCCAACGAGACCCTCCCCAACCTGCCCTCCCCGTTCACCGGCTTCGACCAGCTCGTCA
AGGTGTTCGCCGACAAAGGGCTCGACGCCTTCGACATGATCACGCTCTCCGGCGCGCACAGCATCGGCCGCTCCCACTGCTCCTCCTTCACCAGGGACCGCCTGCCGCCCAGCAACACCA
CCGACATAGACCCAGCGTTCGCCGCCACGCTGCAGGCTAGCTGCGCGTCGCCCAACGGCACCGACAACACGGTCATGCAGGACTTCAAGACCCCCGACGTCCTGGACAACCAGTACTACA
AGAACGTGCTGGCCCACAAGGTTCTCTTCACGTCGGACGCCGCGCTCACCACCAACTTCACGTCCAACAACCTGGTGCGCGCCTACGCGGACTTCGTGCCCTATCTGTGGCAGCAGAAGT
TCGCGAAAGCCATGGTGAAGATGGCCGGCGTCGAGATCAAAACCGCCGCCAACGGAGAGATCAGGAAGACATGCCGCAAGGTCAACAGCAGGTCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAACCTCTAAGCTCGCTGTCCTCACTCTGTTTGCCCTGCTCGGCTCCGTGTCATGCCAGTCCGGTGGCTACTACTTCTACCCAACCCCGCAGCAACCATCTCCAACACCCAGCCCT
CCTTCTAGTCCGCAACTCATGGTCGGATACTACAAGGACAAGTGTGCCGCTTACGTGGATGTTGAAGCTATTGTCAAGAAGCACGTCAAGGCCACCGATGCTGGCATGCAGGCCGGGCTT
GTCCGTCTCTTATTCCACGACTGCTTCGTCCGT
GGATGCGACGGCTCCGTCCTCCTCGACACGTTCAGCAACGACACCAGCCTGACCCCGGAGAAGTTCGGCGTGCCCAACTTCCCCAGC
CTGCGGGGCTTCGAGGTGATCGACGCGGCCAAAGCCGAGATCGAGGCGGCGTGCCCCGGCACGGTCTCGTGCGCGGACATCGTCGCGTTCGCCGGCCGCGATGCGTCCTACTTCCTCAGC
GGCGGCGGCATCAACTTCGCCATGCCCGCGGGGCGCTACGACGGGAACGTCTCCCTCGCCAACGAGACCCTCCCCAACCTGCCCTCCCCGTTCACCGGCTTCGACCAGCTCGTCAAGGTG
TTCGCCGACAAAGGGCTCGACGCCTTCGACATGATCACGCTCTCCGGCGCGCACAGCATCGGCCGCTCCCACTGCTCCTCCTTCACCAGGGACCGCCTGCCGCCCAGCAACACCACCGAC
ATAGACCCAGCGTTCGCCGCCACGCTGCAGGCTAGCTGCGCGTCGCCCAACGGCACCGACAACACGGTCATGCAGGACTTCAAGACCCCCGACGTCCTGGACAACCAGTACTACAAGAAC
GTGCTGGCCCACAAGGTTCTCTTCACGTCGGACGCCGCGCTCACCACCAACTTCACGTCCAACAACCTGGTGCGCGCCTACGCGGACTTCGTGCCCTATCTGTGGCAGCAGAAGTTCGCG
AAAGCCATGGTGAAGATGGCCGGCGTCGAGATCAAAACCGCCGCCAACGGAGAGATCAGGAAGACATGCCGCAAGGTCAACAGCAGGTCCTGA

Retrieve as FASTA