Entry information : Pcar2CysPrx01-1 (Pcar2CysPrx01-a)
Entry ID 9930
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-12-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: Pcar2CysPrx01-1 (Pcar2CysPrx01-a)
Name (synonym) Pcar2CysPrx01-1 (Pcar2CysPrx01-a)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pcar2CysPrx01-1
start..stop
S start..stop
Pc2CysPrx01-1 417 2e-151 1..211 1..211
Pc2CysPrx01-2 392 1e-141 1..199 1..199
Ccin2CysPrx 349 2e-124 1..211 1..211
Ppl2CysPrx01-1B 342 2e-121 1..211 1..210
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1771431..1771531 101 N° 2 1771587..1771610 24 N° 3 1771663..1771748 86 N° 4 1771797..1772074 278
N° 5 1772128..1772274 147  
join(1771431..1771531,1771587..1771610,1771663..1771748,1771797..1772074,1772128 ..1772274)


exon

Literature and cross-references Pcar2CysPrx01-1 (Pcar2CysPrx01-a)
DNA ref. JGI genome:   scaffold_10 (1771431..1772274)
EST ref. GenBank:   HS496453.1
Protein sequence: Pcar2CysPrx01-1 (Pcar2CysPrx01-a)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   211
PWM (Da):   %s   23200.85  
PI (pH):   %s   5.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAQVQKPAPTFKAQAVVDGVFQDVSLSDYLGQWVVLFFYPMDFTFVCPTEILAFNDSLDAFKELNTVVGVSTDSTYSHFAWASQPRNQGGLGPSLKLPLIADRNMKISRDYGVLLEDEGIALRGLFIVDPQGVLRQITVNDLPVGRSVDETVRLIQAFQFEKHGEVCPANWKEGGKTMKADPKGSLEYFSTVNPNGTDDGARKRPRVE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 2 ESTs (HS496454.1). The alternative splicing is not confirmed.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGCTCAGGTCCAGAAGCCCGCACCTACTTTCAAGGCTCAGGCCGTTGTTGACGGTGTCTTCCAGGACGTCTCCCTTTCTGACTACCTTGGCCAATGGTGGGTCTAACGGATTTCA
TGCATCGTGCATGGAGCTAACTTGCAGATAACGCAGGGTTGTTCTGTTCTTCTACCCTATGTGAGTCACACAAGTCGCGTATTCACGAGTCGCCACTCAGGCGTGCCATCAGGGACTTTA
CCTTTGTGTGCCCCACAGAGATTCTCGCCTTCAATGACTCTCTCGACGCTTTCAAGGAGCTGAACACCGTTGTTCTCG
GTGAGTGCTTTCCTGTTTTCACGTGAATAATCACCTGATCTG
GTATAGGTGTTTCTACCGACTCGACCTACTCCCACTTCGCCTGGGCCTCTCAGCCTCGCAACCAGGGCGGCCTCGGCCCTAGCCTCAAGCTCCCCCTGATCGCTGATCGCAATATGAAGA
TTTCCCGCGACTATGGTGTCCTCCTCGAAGATGAGGGTATCGCTCTCCGTGGCCTCTTCATCGTCGACCCCCAGGGTGTCCTCCGCCAGATTACCGTCAACGACCTTCCCGTCGGCCGCT
CCGTCGATGAGACCGTCCGCCTCATCCAGGCATTCCAGTTCGTC
GTGCGTATCTTTGTGCTTGTAATATATTAAACCATACTCATGAGCTCCTGCAGGAGAAGCACGGTGAAGTCTGTCC
CGCCAACTGGAAGGAAGGTGGCAAAACCATGAAAGCCGACCCGAAGGGCTCCCTTGAGTACTTCTCTACAGTTAATCCAAACGGTACGGATGATGGTGCGAGGAAGCGCCCTCGCGTCGA
ATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGCTCAGGTCCAGAAGCCCGCACCTACTTTCAAGGCTCAGGCCGTTGTTGACGGTGTCTTCCAGGACGTCTCCCTTTCTGACTACCTTGGCCAATGGGTTGTTCTGTTCTTCTAC
CCTAT
GGACTTTACCTTTGTGTGCCCCACAGAGATTCTCGCCTTCAATGACTCTCTCGACGCTTTCAAGGAGCTGAACACCGTTGTTCTCGGTGTTTCTACCGACTCGACCTACTCCCAC
TTCGCCTGGGCCTCTCAGCCTCGCAACCAGGGCGGCCTCGGCCCTAGCCTCAAGCTCCCCCTGATCGCTGATCGCAATATGAAGATTTCCCGCGACTATGGTGTCCTCCTCGAAGATGAG
GGTATCGCTCTCCGTGGCCTCTTCATCGTCGACCCCCAGGGTGTCCTCCGCCAGATTACCGTCAACGACCTTCCCGTCGGCCGCTCCGTCGATGAGACCGTCCGCCTCATCCAGGCATTC
CAGTTCGTC
GAGAAGCACGGTGAAGTCTGTCCCGCCAACTGGAAGGAAGGTGGCAAAACCATGAAAGCCGACCCGAAGGGCTCCCTTGAGTACTTCTCTACAGTTAATCCAAACGGTACG
GATGATGGTGCGAGGAAGCGCCCTCGCGTCGAATGA

Retrieve as FASTA