Entry information : Pc2CysPrx01-1 (Pc2CysPrx01-a)
Entry ID 9931
Creation 2011-12-09 (Christophe Dunand)
Last sequence changes 2011-12-09 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2012-04-19 (Catherine Mathe)
Peroxidase information: Pc2CysPrx01-1 (Pc2CysPrx01-a)
Name (synonym) Pc2CysPrx01-1 (Pc2CysPrx01-a)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pc2CysPrx01-1
start..stop
S start..stop
Pcar2CysPrx01-1 417 2e-151 1..211 1..211
Pc2CysPrx01-2 409 3e-148 1..199 1..199
Ccin2CysPrx 352 2e-125 1..211 1..211
Ppl2CysPrx01-1B 344 1e-122 1..211 1..210
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 115050..115150 101 N° 2 114979..115002 24 N° 3 114842..114927 86 N° 4 114515..114792 278
N° 5 114315..114461 147  
complement(join(114315..114461,114515..114792,114842..114927,114979..115002,1150 50..115150))


exon

Literature and cross-references Pc2CysPrx01-1 (Pc2CysPrx01-a)
DNA ref. JGI genome:   scaffold_19 (115150..114249)
EST ref. GenBank:   DV753353.1
Protein sequence: Pc2CysPrx01-1 (Pc2CysPrx01-a)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   211
PWM (Da):   %s   23269.97  
PI (pH):   %s   5.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAQVQKPAPTFKAQAVVDGVFQDVSLSDYLGQWVVLFFYPMDFTFVCPTEILAFNDSLEAFKELNTVVGVSTDSAYSHFAWASQPRNQGGLGPNLKLPLIADRNMKISRDYGVLLEEDGVALRGLFIIDPKGVLRQITVNDLPVGRSVDETIRLIKAFQFEKYGEVCPANWKEGGKTMKADPKGSLEYFSTVNTNGTDDGARKRPRLE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 3 ESTs (DV754713.1, DV764541.1). Strain="RP-78". Alternative splicing of the last intron.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGCTCAGGTCCAGAAGCCCGCCCCCACCTTCAAGGCTCAGGCCGTTGTCGACGGTGTCTTCCAGGATGTCTCTCTTTCCGACTACCTCGGCCAATGGTATGTTGCACTACATTGC
AAACGTACGGCTCGCTAATATCGCACAGGGTCGTCCTCTTCTTCTACCCCATGTGAGTTGCAAACGACGCGTCAAATCTGACATGCCACTAACATGTCATCAGGGACTTCACCTTTGTCT
GCCCCACCGAGATTCTCGCCTTCAACGACTCTCTTGAGGCGTTCAAGGAGTTGAACACTGTCGTTCTCG
GTATGTGCATTTGAATGTCTTTCGCGGAGCGCATTCTGATACGTTGCAGGT
GTTTCCACCGACTCTGCCTACTCCCACTTCGCCTGGGCGTCCCAGCCCCGCAACCAGGGCGGTCTCGGCCCCAACCTCAAGCTCCCGCTCATCGCCGACCGCAACATGAAGATCTCCCGC
GACTACGGCGTTCTCCTCGAGGAGGACGGTGTTGCTCTTCGCGGCCTCTTCATCATCGACCCTAAGGGCGTCCTCCGCCAGATCACCGTCAACGATCTCCCTGTCGGCCGCTCCGTCGAC
GAGACCATCCGCCTCATCAAGGCGTTCCAGTTCGTC
GTACGTGTTCATGTTCTTGCTCAGCGTTGCACGTGTCACTCACTTCCTTGCAGGAGAAGTACGGCGAAGTCTGCCCCGCCAACT
GGAAGGAGGGTGGCAAGACCATGAAGGCCGACCCGAAGGGTTCCCTCGAGTACTTCTCCACTGTCAACACCAATGGTACGGACGACGGTGCGAGGAAGCGCCCCCGCCTCGAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGCTCAGGTCCAGAAGCCCGCCCCCACCTTCAAGGCTCAGGCCGTTGTCGACGGTGTCTTCCAGGATGTCTCTCTTTCCGACTACCTCGGCCAATGGGTCGTCCTCTTCTTCTAC
CCCAT
GGACTTCACCTTTGTCTGCCCCACCGAGATTCTCGCCTTCAACGACTCTCTTGAGGCGTTCAAGGAGTTGAACACTGTCGTTCTCGGTGTTTCCACCGACTCTGCCTACTCCCAC
TTCGCCTGGGCGTCCCAGCCCCGCAACCAGGGCGGTCTCGGCCCCAACCTCAAGCTCCCGCTCATCGCCGACCGCAACATGAAGATCTCCCGCGACTACGGCGTTCTCCTCGAGGAGGAC
GGTGTTGCTCTTCGCGGCCTCTTCATCATCGACCCTAAGGGCGTCCTCCGCCAGATCACCGTCAACGATCTCCCTGTCGGCCGCTCCGTCGACGAGACCATCCGCCTCATCAAGGCGTTC
CAGTTCGTC
GAGAAGTACGGCGAAGTCTGCCCCGCCAACTGGAAGGAGGGTGGCAAGACCATGAAGGCCGACCCGAAGGGTTCCCTCGAGTACTTCTCCACTGTCAACACCAATGGTACG
GACGACGGTGCGAGGAAGCGCCCCCGCCTCGAATGA

Retrieve as FASTA