Entry information : PcarGPx01
Entry ID 9933
Creation 2011-12-09 (Christophe Dunand)
Last sequence changes 2011-12-09
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PcarGPx01
Name PcarGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarGPx01
start..stop
S start..stop
BaGPx01 285 4e-100 7..162 58..213
PcGPx 283 6e-100 5..162 2..159
DsGPx01 281 3e-98 7..162 82..237
PbreGPx01 277 1e-96 5..162 68..225
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2889145..2889260 116 N° 2 2889001..2889091 91 N° 3 2888775..2888948 174 N° 4 2888615..2888722 108
complement(join(2888615..2888722,2888775..2888948,2889001..2889091,2889145..2889 260))


exon

Literature and cross-references PcarGPx01
DNA ref. JGI genome:   scaffold_3 (2889260..2888615)
Protein sequence: PcarGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   18068.16  
PI (pH):   %s   5.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTQPTPFYDLKTQQPDGKTYDFEQLKGKVVLIVNVASKCGFTPQYKGLEALHKKYKDQGLVILGFPCNFGGQEPGTDQEVADFCEVNYGVTFPLMAKSDVNGENVNEVYKYLKEQKSGLLGLTRIKWNFEKFLVDKEGNVVNRWASTTSPEAIDAEIAKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCCAGCCGACCCCGTTCTACGACCTTAAGACTCAACAGCCCGATGGCAAGACTTACGATTTCGAGCAGCTGAAGGGAAAAGTCGTTTTGATCGTGAATGTCGCCTCCAAGTGGTAC
GTGATGCAGGCTGTCTGCCACCTTCCTCCCCCGCTCACGCCACATCCAGTGGTTTCACGCCACAGTACAAGGGCCTCGAGGCACTGCACAAGAAGTACAAGGATCAAGGTCTTGTGATCC
TCGGATTCCCCTGCAACCAG
GTATGTAGCGCTACCCTCCGCACCAGGTCCTCACTGACGTCGAGCCGTGCAGTTTGGCGGCCAGGAGCCAGGCACCGATCAAGAGGTCGCAGATTTCTGC
GAGGTAAATTACGGTGTGACGTTCCCCCTCATGGCGAAGTCGGACGTGAACGGCGAGAACGTGAATGAGGTCTACAAGTACCTCAAGGAGCAGAAGTCGGGTCTTCTCGGCTTGACGCGC
ATCAAG
GTGTGTTTCCGTCTTTCTTGGCAACCGGAGCCGGTGCTGACAAGCGTTGTAGTGGAATTTTGAAAAGTTTTTGGTCGACAAGGAGGGCAATGTCGTCAACCGATGGGCGTCAAC
GACTTCGCCAGAGGCCATTGACGCGGAAATCGCTAAGCTGCTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCCAGCCGACCCCGTTCTACGACCTTAAGACTCAACAGCCCGATGGCAAGACTTACGATTTCGAGCAGCTGAAGGGAAAAGTCGTTTTGATCGTGAATGTCGCCTCCAAGTGTGGT
TTCACGCCACAGTACAAGGGCCTCGAGGCACTGCACAAGAAGTACAAGGATCAAGGTCTTGTGATCCTCGGATTCCCCTGCAACCAG
TTTGGCGGCCAGGAGCCAGGCACCGATCAAGAG
GTCGCAGATTTCTGCGAGGTAAATTACGGTGTGACGTTCCCCCTCATGGCGAAGTCGGACGTGAACGGCGAGAACGTGAATGAGGTCTACAAGTACCTCAAGGAGCAGAAGTCGGGTCTT
CTCGGCTTGACGCGCATCAAG
TGGAATTTTGAAAAGTTTTTGGTCGACAAGGAGGGCAATGTCGTCAACCGATGGGCGTCAACGACTTCGCCAGAGGCCATTGACGCGGAAATCGCTAAG
CTGCTGTGA

Retrieve as FASTA