Entry information : ZmPrxII03 (ZmPrxIIC)
Entry ID 994
Creation 2007-11-09 (Christophe Dunand)
Last sequence changes 2010-12-23 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-12-28 (Christophe Dunand)
Peroxidase information: ZmPrxII03 (ZmPrxIIC)
Name (synonym) ZmPrxII03 (ZmPrxIIC)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Endosperm
Meristems
Pericarps
Roots
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrxII03
start..stop
S start..stop
SbPrxII03 324 3e-116 1..162 1..162
SpPrxII03 323 1e-115 1..162 1..162
HvPrxII03 306 4e-109 1..162 1..162
ScPrxII03 299 4e-106 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150362551..150362705 155 N° 2 150359325..150359404 80 N° 3 150358837..150359090 254  
complement(join(150358837..150359090,150359325..150359404,150362551..150362705))


exon

Literature and cross-references ZmPrxII03 (ZmPrxIIC)
Literature Verza,N.C., Silva,T.R., Cord-Neto,G., Nogueira,F.T.S., Fisch,P.H., De Rosa,V.E. Jr., Rebello,M.M., Vettore,A.L., da Silva,F.R. and Arruda,P. Endosperm-preferred expression of maize genes as revealed by transcriptome-wide analysis of expressed sequence tags Plant Mol. Biol. 59 (2), 363-374 (2005).
DNA ref. GenBank:   AC195536.3 (14463..10610)
EST ref. GenBank:   CO458681
Cluster/Prediction ref. UniGene:   Zm.66917
Protein sequence: ZmPrxII03 (ZmPrxIIC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17198.94  
PI (pH):   %s   4.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIAVGDALPDGQLGWFDENDQLQQVSVHALAAGKKVILFGVPGAFTPTCSNQHVPGFITQAEQLKAKGVDEILLIVNDPFVMKAWAKTYPENKHVKFLADGSGAYTKALDLELDLTDKGLGVRSKRFALLADDLTVTVANIEEGGQFTISGAEEILKAL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 2 introns) and 320 ESTs. Also found in AC200487.4.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCCATCGCTGTCGGCGACGCCCTCCCCGACGGCCAGCTCGGGTGGTTCGACGAGAACGACCAGCTGCAGCAGGTCTCCGTCCACGCGCTCGCCGCCGGCAAGAAGGTCATCCTC
TTCGGCGTCCCCGGCGCCTTCACCCCGACCTGCAG
GTCCCTACGCCCTGTCCCCTGCCCCGTCTCTTCCTCCCACTCTCTCGGAGATCTCCGAGCCTTTTGGCCCCTGTGTTTTGGGGGA
GAACGGTCTCGGTCGGTTCGGCGGGCGGTTATATGGGCTCTCTTGGGATTAGTTCCAGTCCGGATTCGGAATGAATACTAGTGGTTTAGTTTTGAGCAACAGATCTACGAGGAAAAAATT
GGGCGGGGGTGGGGGTTGAGTTTTTTTAGCCATGCCAGCTGCGCTTTCTGCTGCAAGTGGGTATCCGGCAGAGAAGAGCAACCATGCTTGTGCGCTGAGAGGATCGTGAAATAGTCTGGC
CTTAAATTGCAGCACAACCGGTTCCACCTCCTAGTCAGCGTCATGCGCGTTGCTGGCAGTAAGGAGCGGAACCTCTCAACGTTGGGTCAGCAAGAAAACCACGGCCGTCAAGTGGAGGGA
GGGGTCTATGGACGCAGGGGCGGAGCCAGAATTATGTTATATGAGGGGCCCAGCAAATTTATCAAATCCTATAACGCACCGTTTGGATCATTGGAATTGAATTTCATTCTAATAACGCCC
CGTTTGGATCACTGGAATTGAATTCCATTCTAATAATAGTAATTTAGGCATATATCAATTAAGCTAATTCACTTTTATACAAAATATATTTGTATACTCTTATTAGCAAGATGTCCTAGA
TATTTATGTGCTACATTTTTACTATAGAGTAGTAGAACGAAGAGTGTCATGTAAGTTACAGATTAGAAACAAATTCTAATCATGCATAAAATCATTTCCTATCCTCCACCCTATGAATTT
GAGATAGGCTTATATCTGAATTTTGGAAAATGGTGGAATGCCAAATTCCAAACTAAATAAGTTACTTTATTGAGTGAATTCCAATTCCTTTAAAATGAAGGGATCCAAACGCCCCGTAAT
AGTAATTTAGCCATATACCAATTAAGCTAATTCGGTTTTATGCAAAATATGTCTGTATACTATTATTAGCAAGATGTCAGAGATATTTATTTGCTATATTTTTACTATAAAGGAGTGAGT
TGAAGAGCGTCCTATAAGTTATAGAGTAGAAACAAATTCTACTAATAAATAAAATTATTTTTCATCTTCCACCCCATGAATTTGTGATAGGCTTATATCTGAACTTTAGAAACTGGTGGA
ATGTCAAATTCCAAGCTAAATAGGTTACTTTATTAAGTGAATTCAATTCCTCTAAAATAAAGGGATCCAAACGCCCTGTAAGGTACAAAATATAATAGGATATATACACATGTATATACT
AATTTGCGTATATCAATAAATTATTAAAAAAAATACTTACACCATATAATTGTAAATTAATTAATTCCAACAGAGATCAAAATAATTAGCCTGTACGATGATCGACCAAATTAAAAGCTT
CGATTATATTATGAGTCATAGTTGTCAATTCTATATCAATATAGATCGATGATCAAGTAACTTTACATAAAAACTTTACATAAAATCATCTACCATTTTATTTCGTAGATGTGCTTTGAT
AAGTTTTGTAGCTAAAAGGCTCTCTCAATGGTTGCAGTTGAGATTAGAAGGGTGATCATTAATCTTAATAATCCGTAAACCATTTGATACATGGAACTTTTACACAATTTAAGATGGTTT
TTTACTAAATTGGTAAGTGATCGTAATGTATTTGGCTCTAGATGGTTGTATAATCAAGGTGAAACATCAAATTTGTCACGTGCACAACAACTATTTGGTGACAACATTGGACTGAAATTC
GTCGATTTTATTATTAGAAACGAATTTGATGCTTCAAATTTTGCAACAAAATTTTAGTTGGATAGAGAAATTTATTTTAACCAAAGAAACTTTTATGTTTCATAGTATGTGTACGGGAGA
GTTAAGGGGGGCCAAGGTCCCTGACCCTTGTCTCTATCTTCTTAATATTTATCTAAAACGCAGTCCTCCTGCGTTTTTCGAGAAAAAAGGCCCCTGCCCCCTTGCTCCGCCCCTGTATTG
AGGCGCTATTCTGAACCTCTAAACTACTAATAGTTAGCTGCTAAAATTAGCTGAGTGATTTAGAACATGTCAGCTAATTGTTAGTTATGCCTCTCAAATAGCATAGCTATTAGTTGTTAG
CTGCTCCAACCCACCCAAAACCAGCTAATGACTTATTAGTTGACTAACAATTAGGTGTTGTTTGGTTCATATATTTGTAACGTAATGGGTAGCCGATAACTTTACATCATGTTTTTTTAA
GTCCAACCATAATCAGATATCACACTAGGGACTAATATCGACATATTCAAAGTTTCAAACTTGTTACCACTGGTACTCGGGTGTGAACCATTTCCATTTACGTTACATTTCGTGAACCAA
ACAACACCTTAGCTCTAGAGGCTTGGAACAGGTCTTAGTTCGCCCAACTGTACATGCAACTTGAATAAGGACTGCGATTGTTGAGATCTGAGCCTTCAAGCAGCACCCATCCCACAAACG
ATGGGAAGAGAAAGTGTCGCGCATGTAGAAAGATCCGCATCTTCAGTGGAAACCACGGCCCCCTCCCAATTAATGGATTGTGATTGTGATTGTGTAGGCAGGTCCTTCTTGATTAATTGT
CCCTTTACAGACCAGTGTATTTTTCATGCATTGTAGCTTTCCTCTTGTAGCTACTGAATTTTATCTAGTCTAACTACAGCCCATGATTCCAGTTTATAGTGTGAACAAAAGGTATTATCT
CTTGTTTTGGTTATTTACGGATCATAGCTAGTTTGAGTTAGTGCTTATTACTCCTCTATTCCAAATTGTAAGCCGTTTTGGGTTTTCTAGGTGCATAGCAAAGGCGCATAGATATACATT
ATTGTCTATACACGCAGTAAAAAGTAAAAAGTATATGTATATAAAAAGGTCAGAACGGCATACCAATTTTGGAATGAAAAGGGAGTACTAACCTAAAATTGCTTAGCTGCTTTAGTTCGA
GAAGCTCAATGGAAAATTGCAAACTACTTAAAATCTAAAAGGATTAGATTTGAAGGTAAATTCCACTAACCGAAGCCAGTAGTTTTGTTGCTTCCTATATCTCTGAAATCTTTCTACTGT
TCTGTGAAAAGCTGAAGCACTCATGCTGTCTCTATTCCGTGCGTGTCTTCTATGTTCATAGCAACCAGCATGTGCCAGGCTTCATCACACAGGCTGAGCAGCTCAAAGCCAAGGGTGTAG
ACGAGATCCTGCTTATCAGCG
GTACGTTTCCAGCATATGTTTGCCTGTCTGTCTTTTTTTTTTTTGCTTATTTCTTCATCGTCAAATGTTTAAAGCTTAAAACAAAAGCAAAATCCTGAC
CTACTATCCTGTTTTACACGGACTGAATACCATCAGTTTGCCATGTTGCGCGTGTATGGCCTCCTCGACCAAAAGCAGCTAGTAGGCCAGCCAGAGCCAGATCATGACAGAACTTGTTTC
CGCTGTGACATGCAGTTAACGACCCCTTCGTCATGAAGGCGTGGGCGAAGACCTACCCCGAGAACAAGCACGTGAAGTTCCTCGCCGACGGATCTGGAGCGTACACCAAGGCGCTCGACC
TCGAGCTCGATCTCACGGACAAAGGGCTGGGCGTGCGCTCGAAGAGGTTCGCTCTCCTGGCCGACGACCTCACGGTCACCGTCGCAAACATCGAGGAAGGCGGGCAGTTCACGATCTCCG
GCGCTGAGGAGATCCTGAAGGCGCTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCCATCGCTGTCGGCGACGCCCTCCCCGACGGCCAGCTCGGGTGGTTCGACGAGAACGACCAGCTGCAGCAGGTCTCCGTCCACGCGCTCGCCGCCGGCAAGAAGGTCATCCTC
TTCGGCGTCCCCGGCGCCTTCACCCCGACCTGCAG
CAACCAGCATGTGCCAGGCTTCATCACACAGGCTGAGCAGCTCAAAGCCAAGGGTGTAGACGAGATCCTGCTTATCAGCGTTAAC
GACCCCTTCGTCATGAAGGCGTGGGCGAAGACCTACCCCGAGAACAAGCACGTGAAGTTCCTCGCCGACGGATCTGGAGCGTACACCAAGGCGCTCGACCTCGAGCTCGATCTCACGGAC
AAAGGGCTGGGCGTGCGCTCGAAGAGGTTCGCTCTCCTGGCCGACGACCTCACGGTCACCGTCGCAAACATCGAGGAAGGCGGGCAGTTCACGATCTCCGGCGCTGAGGAGATCCTGAAG
GCGCTTTAG

Retrieve as FASTA