Entry information : MguPrx108 ( Migut.F02127.1 [2.0]/ mgv1a027126m.g [1.0] )
Entry ID 9943
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2016-01-18 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-18 (Achraf Jemmat)
Peroxidase information: MguPrx108 ( Migut.F02127.1 [2.0]/ mgv1a027126m.g [1.0] )
Name (synonym) MguPrx108 ( Migut.F02127.1 [2.0]/ mgv1a027126m.g [1.0] )
Class Class III peroxidase    [Orthogroup: Prx138]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx108
start..stop
S start..stop
MguPrx22 679 0 1..333 1..333
MguPrx02 562 0 10..333 1..325
MguPrx29 511 0 7..333 3..330
MguPrx27 508 0 6..333 3..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 886..1126 241 N° 2 1..761 761  
complement(join(1..761,886..1126))


exon

Literature and cross-references MguPrx108 ( Migut.F02127.1 [2.0]/ mgv1a027126m.g [1.0] )
DNA ref. Phytozome 12:   scaffold_1174 (1125..3)
Protein sequence: MguPrx108 ( Migut.F02127.1 [2.0]/ mgv1a027126m.g [1.0] )
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (307)
PWM (Da):   %s   35966.64 (33241.1) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.63 (8.56) Peptide Signal:   %s   cut: 27 range:27-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAARNSHALIIIGLLLSCFILFVSAADDNSTAALTVGFYKNSCPFAEIIVRKYVNKFVTFNPGFAAGLIRLHFHDCFVRGCDASVLLDGKNSEKQSIPNKGSLRGFEIIDAAKAELEVKCPGIVSCADILAFSARDSAWKAGNIFYEVPAGRRDGNVSNTLDPLLNLPPPFFNATQLRDNFARKGLTLDEMVTLSGAHSIGIAHCTSFLGRLYPTVDPTLDPKYAAKLKKICPAPVANATGPPKVNPTVNQDTITPIRLDNLYYLGLKQKKGLFTSDQDLMTSPLTSNIVLNNIQFGGVWATKFAAAMVKMGNIDVLTGVQGEVREHCRHIN

Retrieve as FASTA  
Remarks Complete squence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCAGCTAGAAATTCCCATGCACTCATAATTATTGGGTTGCTTCTCTCTTGCTTCATATTGTTTGTTTCAGCCGCTGATGATAATTCAACCGCCGCCCTCACAGTTGGCTTCTAC
AAAAACTCCTGTCCCTTTGCAGAAATCATTGTCCGAAAATACGTCAACAAATTCGTCACTTTCAACCCTGGTTTTGCTGCTGGCCTTATCAGGCTGCACTTCCACGATTGCTTTGTCAGG
G
TATGTATATATGTACATTCTCGTTAATTTTTTTTTAGATATTATATCAATCTTCTTTTCGTTTCCTAAATATATATATATATATATATATATATATGTGTGTTTTTAATTAATTTACCT
ATAGGGTTGTGATGCTTCTGTGTTGTTGGATGGAAAAAACTCGGAAAAGCAAAGTATACCAAACAAGGGAAGCCTACGTGGGTTCGAAATAATAGACGCAGCAAAAGCAGAACTTGAGGT
GAAATGCCCTGGAATTGTTTCATGTGCAGACATTCTCGCCTTCTCAGCCAGAGACAGCGCCTGGAAAGCTGGCAACATATTCTACGAAGTACCCGCTGGACGCCGTGATGGAAATGTATC
CAACACACTCGACCCACTTCTAAATCTTCCCCCGCCCTTCTTCAACGCAACTCAACTCAGGGACAATTTTGCAAGAAAGGGTCTCACACTCGACGAAATGGTTACACTTTCAGGGGCTCA
CTCCATTGGAATTGCTCATTGTACTTCCTTCTTAGGACGTCTATACCCGACAGTGGACCCCACTCTGGACCCCAAGTACGCTGCTAAGTTGAAAAAGATATGCCCTGCGCCTGTTGCTAA
TGCGACCGGTCCACCGAAAGTGAACCCCACAGTCAATCAGGATACCATCACTCCGATTCGTTTGGACAATTTATACTACTTGGGATTGAAGCAGAAAAAGGGGCTTTTTACGTCGGATCA
GGATCTTATGACAAGCCCTTTGACTTCCAATATTGTTCTCAACAATATTCAGTTTGGTGGTGTGTGGGCTACCAAGTTTGCTGCTGCCATGGTCAAAATGGGAAATATTGATGTGCTCAC
CGGCGTCCAGGGCGAGGTCAGGGAACACTGCCGCCACATCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCAGCTAGAAATTCCCATGCACTCATAATTATTGGGTTGCTTCTCTCTTGCTTCATATTGTTTGTTTCAGCCGCTGATGATAATTCAACCGCCGCCCTCACAGTTGGCTTCTAC
AAAAACTCCTGTCCCTTTGCAGAAATCATTGTCCGAAAATACGTCAACAAATTCGTCACTTTCAACCCTGGTTTTGCTGCTGGCCTTATCAGGCTGCACTTCCACGATTGCTTTGTCAGG
G
GTTGTGATGCTTCTGTGTTGTTGGATGGAAAAAACTCGGAAAAGCAAAGTATACCAAACAAGGGAAGCCTACGTGGGTTCGAAATAATAGACGCAGCAAAAGCAGAACTTGAGGTGAAA
TGCCCTGGAATTGTTTCATGTGCAGACATTCTCGCCTTCTCAGCCAGAGACAGCGCCTGGAAAGCTGGCAACATATTCTACGAAGTACCCGCTGGACGCCGTGATGGAAATGTATCCAAC
ACACTCGACCCACTTCTAAATCTTCCCCCGCCCTTCTTCAACGCAACTCAACTCAGGGACAATTTTGCAAGAAAGGGTCTCACACTCGACGAAATGGTTACACTTTCAGGGGCTCACTCC
ATTGGAATTGCTCATTGTACTTCCTTCTTAGGACGTCTATACCCGACAGTGGACCCCACTCTGGACCCCAAGTACGCTGCTAAGTTGAAAAAGATATGCCCTGCGCCTGTTGCTAATGCG
ACCGGTCCACCGAAAGTGAACCCCACAGTCAATCAGGATACCATCACTCCGATTCGTTTGGACAATTTATACTACTTGGGATTGAAGCAGAAAAAGGGGCTTTTTACGTCGGATCAGGAT
CTTATGACAAGCCCTTTGACTTCCAATATTGTTCTCAACAATATTCAGTTTGGTGGTGTGTGGGCTACCAAGTTTGCTGCTGCCATGGTCAAAATGGGAAATATTGATGTGCTCACCGGC
GTCCAGGGCGAGGTCAGGGAACACTGCCGCCACATCAACTGA

Retrieve as FASTA