Entry information : PpeAPx-R (ppa015878m)
Entry ID 9945
Creation 2011-12-13 (Qiang Li)
Last sequence changes 2011-12-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-31 (Christophe Dunand)
Peroxidase information: PpeAPx-R (ppa015878m)
Name (synonym) PpeAPx-R (ppa015878m)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Rosaceae Prunus
Organism Prunus persica (peach)    [TaxId: 3760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpeAPx-R
start..stop
S start..stop
MdAPx-R 537 0 1..319 1..323
VvAPx-R 423 4e-150 23..319 22..330
RcAPx-R 415 5e-147 22..319 18..328
CclAPx-R 414 3e-146 6..319 12..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 39194157..39194304 148 N° 2 39193921..39194032 112 N° 3 39193704..39193831 128 N° 4 39193391..39193461 71
N° 5 39193196..39193238 43 N° 6 39193009..39193105 97 N° 7 39192666..39192749 84 N° 8 39192394..39192509 116
N° 9 39191872..39191929 58 N° 10 39191187..39191286 100  
complement(join(39191187..39191286,39191872..39191929,39192394..39192509,3919266 6..39192749,39193009..39193105,39193196..39193238,39193391..39193461,39193704..3 9193831,39193921..39194032,39194157..39194304))


exon

Literature and cross-references PpeAPx-R (ppa015878m)
DNA ref. Phytozome 12:   scaffold_1 (39194304..39191187)
Protein sequence: PpeAPx-R (ppa015878m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319
PWM (Da):   %s   34228.66  
PI (pH):   %s   6.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTTCTVSLISSTKSSSTFPLKFNFPAKSPSTVNLRANPLTAANAASSGKDLVLGRRGLVFTLTATLPLLLPFSECIEAFAAKAVESDISEYELVKEEIRKVVTKGKAAGVLRLVFHDAGTFQVDENGGMNGSVIYELDRPENKGLKSPFILEKAKSEVDTVQPVSWADMISVAGAEAVSICGGPTIQVSLGRLDSKEPDPEGKLPAESLDAFALRQSFQTKGFSTQELVALSGAHTIGNKGFGSPTVFDNTYFKILLEKPSGSMIGLPSDRALAKDDECLRWITKYAEDQDVFFEDFKKAYVKLVNSGARWKS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 9 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCAACTACCTGCACCGTCTCCCTTATCTCCTCCACTAAATCTTCCTCCACATTCCCATTAAAATTCAATTTTCCCGCCAAATCCCCCTCAACGGTCAATTTGCGCGCCAACCCT
CTCACCGCCGCCAACGCCGCTTCTTCAG
GTAAAAGCAAGCACAACCCTAATGAAGCACGGATTAGATTAGGTGTTGACTGTGTTGGGTTGCTTAGAACAATGGAAGGAAGCTGAATTGTA
CTATTTGATGCACCAATTATTCAAAATCACAGGAAAAGATCTCGTCTTGGGAAGAAGAGGACTGGTATTTACACTTACAGCCACACTGCCATTGCTTCTTCCCTTCTCTGAATGCATAGA
GGCCTTTGCTGCGAAGGCGGTAGA
GTGAGTTAAACAAAATCTTCAATCTTTTCAATTTGTGGGTATTGATATGTGCAAAGTAATTACTGGGTTTTTTCTGTGACATTTGAAAGGTCGGAT
ATAAGTGAATATGAGCTTGTGAAGGAGGAGATTAGGAAGGTGGTGACCAAGGGTAAGGCTGCTGGTGTGCTTCGTTTGGTGTTTCATGATGCAGGGACCTTTCAAGTTGATGAGAATTCA
G
GTATCTATATTTGTATGCATTAGCCATTGCTTTTTACTCATTTCCATGGCTGCATTGGCCTTTCAAATTGAAGCAATATCAACTGGAATTGGGATTCATATACGAATGGTTCAGATTTG
TTGTGAGTAGCCAATACACGAATGGTTCAGATTTGTTGCATTGCACAATCAATTGCCAACCACTGACATGTGTTCCTTTGAAATATAGATATTGTCTGAAGTTCATTCATGTTGTTATTG
CAGGTGGCATGAATGGTTCTGTCATTTACGAACTTGATAGACCAGAAAATAAAGGTCTTAAAAGTCCTTTCAAGGCATGCCCTCTCTCTCTTATATGTGTATCTGTTCATTAGTTTCCAT
CGAATTCCCAAATTCTTAATTTGTTGAACAAAGATATCGATTAAATAAAAGTCGTTTAAACGATCTTCTACCAGCTAACTTCTCAGTGGATTAAATTGTTGGTTAGATTCTAGAGAAAGC
AAAGAGTGAGGTGGATACAGTACAACCAG
GTTTCTATCTTCTGAAATACTGTTTGACTAGGTTTCTGTATTAATGGTTGTTTTAGTGCTGTGCTAACGTGTGGATGTTTCCAAAATTAGT
GTCTTGGGCAGACATGATTTCTGTGGCTGGAGCTGAAGCAGTTTCAATATGTGGAGGTCCAACAATCCAAGTTTCGTTGGGCAGATTAGATTCAAA
GTAAGCTGCATCAATGGAAAAACA
ACCTCATGCTTGAATCCTCAATATTTCAGTTGCCAAGTATTATTAATGCTACTAGAAATACTATAAAGAAAAAGAAAAAAGTAGAGTTAGTGGAAAGAAAACTAAGTCTTGTTTCTCTGC
AGCATTAATATGGAGAATCAATCTAATCCTATCCTACCAAAAATTGATAATTCCAATTTTTAGAAATGACATTGTGAATAGCTACTTATCTCATTCTCTCATCTTTTTGTTTTAGGGAGC
CTGATCCTGAAGGAAAACTTCCTGCAGAATCTCTGGATGCCTTTGCTCTGAGGCAAAGCTTTCAAACAAAAGGCTTTTC
GTGAGTTCATATATGCTAAAAGATACCTTTTTCAATTTGTA
TGTTGTAGATGTATTTTTTTTCCTTTTTGTAAGTAAAGCACCGGGGAAAAGTTTATCATCCCAGTCTCTGCTTGGTACAGGTTTAAACTAAAACGTGACTGTTTTGTTTTTGCAGAACTC
AAGAACTTGTTGCTCTGTCAGGAGCTCATACCATTGGAAATAAAGGTTTCGGAAGTCCAACAGTTTTTGACAATACATACTTCAAAATTCTGCTTGAGAAACCATCTTCGG
GTAAATAAC
AGTGACTTGGATAATCTGCATATCAAAACAGGCTTAAAGAGAAACCCCCTGCACTCACTTAAGCTCGCCCCTCTTGTGGAGTTCATGTTACAAACTTACAACATGAGATAATAACAGAAA
AAAAGGAACATAAAGAGTAATCATGTTCTTTGAGTAATTGCTTTTTCATAAGAGTGAATTTCAATTTTTGTTTGATCTTGAATCAGATTATATTTTTCATTTTCATGCACAAGTACGATT
TAATCAATTTGCTTGATTAATATGGTCCCTCTTCTTTTTTTTTTCCCCACTGAATGCATGCTTTCATGCGATCCATGATAAAGGGAAAACATTATTGCGACTTATCTTTACACCTCTAAA
AATTCATGACTTTGTGTGCATTTATTTTCTCCCCTTGTGAAAGTTTCTTTTTCTTTGCTGTGCGCGCGGTTACTGATTCTATTCTTTGCATGCAGGTAGTATGATTGGGCTTCCTTCAGA
TCGTGCGCTTGCCAAGGATGATGAATGCTTAAG
GTCTATTTTCTTTCAAAAACTTTCAGCTGTCCTTTTTACTGCTATTCCATATGTTGATAAGCATTTAAGCCAGCCAAACCAGTTATT
TAAACAAGTATTGAAATGAATGTAATTCGGCTGGAAGACTTCGAAATAAAGAGCGAATATCTCTTTAAACAGTAGTTATGCAAGACAAATCTAATTTAGGTTAAATCAATCCACAAGTTC
TTTACATTAGTTGAGATAATGATCATCACATGTTTTTTTTCTTTTGTAGAAAGAAAATGTAAGGGTTTAAGTCTGTATCTAATTATCTGGATTTGGAAATGAAATGAAAATTTGTCACGT
TGCCTTGAGCTAGCCAACTAATTTAGTTACTTTGACTTACATATTTCTCATAGATATATGTCTGATTATCTGATATGTTTATGCTCTAGTAATCAGAAAGTTATTAGATATTGCCTAATC
CATGCAAGCTAAACGCATACGTTTTCGGTATACACGAGTATTCATTTGCATTGTAGGTATCAACTTTCATGTTTATGTTACATGTAGTATGTGTTTTGTATTCATATCCGACTGAAGAGA
AGCTTATTTCGTGTACAGATGGATCACAAAGTATGCTGAGGACCAGGACGTTTTCTTTGAAGATTTCAAGAAGGCTTATGTCAAACTAGTGAATTCAGGAGCCAGGTGGAAGAGCTTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCAACTACCTGCACCGTCTCCCTTATCTCCTCCACTAAATCTTCCTCCACATTCCCATTAAAATTCAATTTTCCCGCCAAATCCCCCTCAACGGTCAATTTGCGCGCCAACCCT
CTCACCGCCGCCAACGCCGCTTCTTCAG
GAAAAGATCTCGTCTTGGGAAGAAGAGGACTGGTATTTACACTTACAGCCACACTGCCATTGCTTCTTCCCTTCTCTGAATGCATAGAGGCC
TTTGCTGCGAAGGCGGTAGA
GTCGGATATAAGTGAATATGAGCTTGTGAAGGAGGAGATTAGGAAGGTGGTGACCAAGGGTAAGGCTGCTGGTGTGCTTCGTTTGGTGTTTCATGATGCA
GGGACCTTTCAAGTTGATGAGAATTCAG
GTGGCATGAATGGTTCTGTCATTTACGAACTTGATAGACCAGAAAATAAAGGTCTTAAAAGTCCTTTCAAGATTCTAGAGAAAGCAAAGAGT
GAGGTGGATACAGTACAACCAG
TGTCTTGGGCAGACATGATTTCTGTGGCTGGAGCTGAAGCAGTTTCAATATGTGGAGGTCCAACAATCCAAGTTTCGTTGGGCAGATTAGATTCAAAG
GAGCCTGATCCTGAAGGAAAACTTCCTGCAGAATCTCTGGATGCCTTTGCTCTGAGGCAAAGCTTTCAAACAAAAGGCTTTTC
AACTCAAGAACTTGTTGCTCTGTCAGGAGCTCATACC
ATTGGAAATAAAGGTTTCGGAAGTCCAACAGTTTTTGACAATACATACTTCAAAATTCTGCTTGAGAAACCATCTTCGG
GTAGTATGATTGGGCTTCCTTCAGATCGTGCGCTTGCCAAG
GATGATGAATGCTTAAG
ATGGATCACAAAGTATGCTGAGGACCAGGACGTTTTCTTTGAAGATTTCAAGAAGGCTTATGTCAAACTAGTGAATTCAGGAGCCAGGTGGAAGAGCTTG

Retrieve as FASTA