Entry information : AcoPrx[P]98
Entry ID 9967
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx[P]98
Name AcoPrx[P]98
Class Class III peroxidase     [Orthogroup: Prx007]*
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx[P]98
start..stop
S start..stop
AfpPrx19 392 2e-138 1..257 57..353
AcoPrx11 390 1e-137 1..257 57..353
AcoPrx12 384 4e-135 1..257 57..352
AfpPrx26 382 1e-134 1..257 57..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3466155..3466202 48 N° 2 3466390..3466493 104 N° 3 3466643..3467255 613  
join(3466155..3466202,3466390..3466493,3466643..3467255)


exon

Literature and cross-references AcoPrx[P]98
DNA ref. Phytozome 12:   scaffold_23 (3466155..3467255)
Protein sequence: AcoPrx[P]98
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   256
PWM (Da):   %s   27977.96  
PI (pH):   %s   6.76
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LKQVFRNDTGQAAGLLLTLRPQAFTIINxACGQIISCSDITALAARDSVFLSGxSDYRVPLGRCDGLTFATRNATLENLQLFGSAAWELIASVATKGLDATDLVAIFGDHTIGHGNCWSFTARLYPNQDVNMDQTYSNKLKHICPALNLTQxSNGGTTMLDIRTPNIFDNRYYVDLMNRQGRFM*DQDLYTDRTTRPIVTSFANNQSLFYERLAFSMITMSMLNVLTWTQGEIRANxARTYVTTLVDDEKERKSASF

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' end is missing; Stop in frame). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCAAACAGGTTTTCAGAAATGATACTGGTCAAGCTGCAGGCTTGCTTGTGTTCACTTCGATCACTACTTTGTTCAGGTACTTACCGCTATCTGCACAGTTTATTTGATGATTAGTTTTG
TCCAGTACTTGCCACTATTTCAGGTTACATTTATGAATGATCTTATGTGTTGTACAGTTGTACACTTATACTAATGTCAGTCCAGGAGAACAGGAAGAACCACCAAACTTGACAGTTGAC
ACTCAGACCCCAAGCTTTTACTATCATTAACGANGCTTGTGGTCAAATCATTTCTTGTTCAGACATTACTGCACTAGCTGCTCGTGATTCCGTTTTCCT
GGTACGAATTCCAATTCTATC
TGTTTGACCATAGCTCAACTGAAATTTTTGGGCTGAAGCATCTAGTGTTCTTTAAAGTTCATGCTACACACTTGTAAAATCGACATGAAAAATGGTTGTATGCAAACTAATTCTATCATG
GTCATGAAGTCAGGAGANTCTGATTACAGAGTTCCATTGGGCAGATGTGATGGGCTCACTTTTGCAACAAGAAATGCAACACTCGAAAACCTTCAACTTTTCGGTTCAGCTGCATGGGAG
CTCATTGCTTCTGTTGCCACCAAGGGCTTGGATGCAACCGATCTAGTAGCCATCTTTGGTGATCACACCATTGGCCATGGCAATTGTTGGTCGTTCACTGCACGTTTGTACCCCAACCAG
GACGTAAACATGGACCAGACATATTCAAATAAACTTAAACACATATGCCCTGCACTCAATTTAACTCAATNNTCAAATGGGGGCACCACTATGTTAGATATTCGAACTCCAAACATATTT
GACAACAGATACTATGTGGATCTCATGAATCGGCAAGGTCGATTCATGTGAGACCAAGACTTGTACACTGATAGAACTACTAGACCTATTGTCACAAGTTTTGCCAACAACCAAAGTCTG
TTCTATGAAAGGTTAGCATTTTCCATGATTACGATGAGTATGTTGAATGTGTTAACCTGGACACAAGGTGAGATACGTGCCAATTNNGCTAGGACATATGTGACAACTCTGGTGGATGAC
GAAAAAGAAAGGAAGAGTGCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCAAACAGGTTTTCAGAAATGATACTGGTCAAGCTGCAGGCTTGCTTTTGACACTCAGACCCCAAGCTTTTACTATCATTAACGANGCTTGTGGTCAAATCATTTCTTGTTCAGACATT
ACTGCACTAGCTGCTCGTGATTCCGTTTTCCT
GTCAGGAGANTCTGATTACAGAGTTCCATTGGGCAGATGTGATGGGCTCACTTTTGCAACAAGAAATGCAACACTCGAAAACCTTCAA
CTTTTCGGTTCAGCTGCATGGGAGCTCATTGCTTCTGTTGCCACCAAGGGCTTGGATGCAACCGATCTAGTAGCCATCTTTGGTGATCACACCATTGGCCATGGCAATTGTTGGTCGTTC
ACTGCACGTTTGTACCCCAACCAGGACGTAAACATGGACCAGACATATTCAAATAAACTTAAACACATATGCCCTGCACTCAATTTAACTCAATNNTCAAATGGGGGCACCACTATGTTA
GATATTCGAACTCCAAACATATTTGACAACAGATACTATGTGGATCTCATGAATCGGCAAGGTCGATTCATGTGAGACCAAGACTTGTACACTGATAGAACTACTAGACCTATTGTCACA
AGTTTTGCCAACAACCAAAGTCTGTTCTATGAAAGGTTAGCATTTTCCATGATTACGATGAGTATGTTGAATGTGTTAACCTGGACACAAGGTGAGATACGTGCCAATTNNGCTAGGACA
TATGTGACAACTCTGGTGGATGACGAAAAAGAAAGGAAGAGTGCA

Retrieve as FASTA