Entry information : ZmPrx101 (GRMZM2G107228)
Entry ID 997
Creation 2007-11-13 (Christophe Dunand)
Last sequence changes 2007-11-13 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: ZmPrx101 (GRMZM2G107228)
Name (synonym) ZmPrx101 (GRMZM2G107228)
Class Class III peroxidase    [Orthogroup: Prx085]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Ovaries
Silks
Inducer Fusarium infection
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx101
start..stop
S start..stop
SofPrx06 625 0 1..368 1..372
SbPrx61 599 0 1..368 1..364
SiPrx01 582 0 1..337 1..339
BdiPrx63 541 0 11..367 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59325442..59325690 249 N° 2 59326321..59326746 426 N° 3 59326855..59327286 432  
join(59325442..59325690,59326321..59326746,59326855..59327286)


exon

Literature and cross-references ZmPrx101 (GRMZM2G107228)
Literature Harris,L.J. et al., unpublished
Protein ref. UniProtKB:   B4FU88
DNA ref. GenBank:   AC209994 (61772..63613)
mRNA ref. GenBank:   BT040676
EST ref. GenBank:   EE169593 [5' end]   DT937846 [3' end]
Cluster/Prediction ref. UniGene:   Zm.10377
Protein sequence: ZmPrx101 (GRMZM2G107228)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 368
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
38189.11 Transmb domain: %sTransmembrane domain
Calculation done with TMHMM
The topology is given as the position of the transmembrane helices
separated by i if the loop is on the inside or o if it is on the outside.
For example i7-29o44-66i87-109o means that it starts on the inside,
has a predicted TMH at position 7 to 29, the outside, then a TMH at position 44-66 etc.
i13-35o
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
5.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPVASKGVVMDGAVAVAAVAAAVLLCLHLPAVARGQLQVGFYNTSCPNAESLVRQAVASAFANDSGIAAGLIRLLFHDCFVRGCDASVLLTSANNTAERDAPPNNPSLHGFQVIDAAKAAVEQSCPQTVSCADIVAFAARDSINLTGNLPYQVPSGRRDGNVSLDTEANSNLPAPTFNASQLVASFAAKNLTDEEMVILSGAHTVGRSFCTSFLARIYNGSTPIVDSGLSAGYATLLRALCPSNANSSTPTTTVIDPSTPAVLDNNYYKLLPLNLGLFFSDNQLRVNSTLNASVNSFAANETLWKEKFVAAMVKMGNIQVLTGTQGQIRLNCSIVNNGSSSVGIQQMTVPNSYSGATASLDDEIATS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, intron 1 and 3') and 22 ESTs. Also found in AC217114.5. Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCGGTTGCAAGCAAGGGAGTAGTGATGGACGGTGCGGTGGCGGTGGCGGCAGTGGCCGCCGCCGTGCTGCTGTGCCTCCATCTGCCGGCGGTGGCGCGAGGCCAGCTGCAGGTG
GGGTTCTACAACACGAGCTGCCCCAACGCCGAGTCCCTGGTCCGCCAGGCGGTGGCCAGCGCGTTCGCCAACGACTCCGGCATCGCCGCCGGCCTCATCCGCCTCCTTTTCCACGACTGC
TTCGTCAGG
GTACGTATACATGGATCTGTTTGGGTTCCTTCTCTGCTACTTATACTAAGAGCATCTCCAACAACGTGACCTATAAATGCTTTATAATTTTAAAATAAGTAAATTTTATAG
AATTTAGGGCACCAACAAAACACTCCGCTCCAACAATAAAGCCCCAAATTTAGATTATATGGCAGCCCACTACGGTGTAGTATATTTGAGCCACTTAAGAGAGTGCCCTATAGTTTTTTG
ACAAAATTTGTTGAATTGACGCACTGTTGGAGTGGTTTTTCCTGTGTAGAGCCCTATATTTCGATTTGAGGCATTAATTTGAGTCATTGTTGGAGATGATCTAAGGGAAATTCCCATCGT
ATCGAATAAAGGGTTCACAGTAATCGACATACATATGCCTTGTTTTGGTTTCTTTGGTCGGTTTCCCTTCTTTTTGGGCTTGTGCTTTTGCATGTAAAAAAGAACATTCAACTCTCGTTG
TTCTCTTTACATGCATGGCTAGTTTGTGGTTGTCGTGGTCTTGTTTGTGGTCATCCCTGCCCACTGTACATAGTCACACAGTAGTATCTTCATCTGTCTACTCGATCTCTACTTGTGATT
TTGCAAACGGGATGATGCTCTCATGGTGGTGGTGAACAGGGCTGCGATGCGTCGGTGCTGCTGACCTCCGCCAACAACACGGCGGAGCGTGACGCGCCGCCCAACAACCCGAGCCTCCAC
GGGTTCCAGGTGATCGACGCGGCGAAGGCGGCGGTGGAGCAGAGCTGCCCGCAGACGGTGTCGTGCGCGGACATCGTGGCCTTCGCGGCGCGCGACAGCATCAACCTCACGGGCAACCTG
CCGTACCAGGTGCCCTCGGGCCGCCGGGACGGCAACGTCTCCCTCGACACGGAGGCCAACAGCAACCTGCCGGCGCCAACGTTCAACGCGTCCCAGCTGGTGGCCAGCTTCGCGGCCAAG
AACCTCACCGACGAGGAGATGGTCATCCTCTCCGGCGCCCACACCGTCGGCCGCTCCTTCTGCACATCGTTTCTCGCGCGCATCTACAACGGATCCACCCCGATC
GTACGTACAGTACAG
ATACTGTAAATAGATACTATGATACATCTTCCATTCGTTGTCTTATATACGTATCAGCTAACAACGATTGACGTCCAATGCAATGCTATGCAGGTTGACTCTGGCCTGAGCGCCGGGTAC
GCCACACTGCTGCGCGCGCTGTGCCCGTCCAACGCCAACTCGTCCACGCCCACGACCACGGTGATCGACCCCAGCACGCCGGCGGTGCTGGACAACAACTACTACAAGCTGCTGCCGCTC
AACCTGGGCCTCTTCTTCTCCGACAACCAGCTGCGCGTCAACTCCACGCTCAACGCCTCCGTCAACAGCTTCGCCGCCAACGAGACGCTCTGGAAGGAGAAGTTCGTCGCCGCCATGGTC
AAGATGGGAAACATCCAGGTGCTCACGGGGACCCAGGGCCAGATCAGGCTCAACTGCAGCATCGTCAACAACGGCTCGTCGTCGGTGGGGATCCAGCAGATGACAGTGCCCAACTCCTAC
TCTGGCGCCACCGCGTCCCTTGATGATGAGATCGCCACGAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCGGTTGCAAGCAAGGGAGTAGTGATGGACGGTGCGGTGGCGGTGGCGGCAGTGGCCGCCGCCGTGCTGCTGTGCCTCCATCTGCCGGCGGTGGCGCGAGGCCAGCTGCAGGTG
GGGTTCTACAACACGAGCTGCCCCAACGCCGAGTCCCTGGTCCGCCAGGCGGTGGCCAGCGCGTTCGCCAACGACTCCGGCATCGCCGCCGGCCTCATCCGCCTCCTTTTCCACGACTGC
TTCGTCAGG
GGCTGCGATGCGTCGGTGCTGCTGACCTCCGCCAACAACACGGCGGAGCGTGACGCGCCGCCCAACAACCCGAGCCTCCACGGGTTCCAGGTGATCGACGCGGCGAAGGCG
GCGGTGGAGCAGAGCTGCCCGCAGACGGTGTCGTGCGCGGACATCGTGGCCTTCGCGGCGCGCGACAGCATCAACCTCACGGGCAACCTGCCGTACCAGGTGCCCTCGGGCCGCCGGGAC
GGCAACGTCTCCCTCGACACGGAGGCCAACAGCAACCTGCCGGCGCCAACGTTCAACGCGTCCCAGCTGGTGGCCAGCTTCGCGGCCAAGAACCTCACCGACGAGGAGATGGTCATCCTC
TCCGGCGCCCACACCGTCGGCCGCTCCTTCTGCACATCGTTTCTCGCGCGCATCTACAACGGATCCACCCCGATC
GTTGACTCTGGCCTGAGCGCCGGGTACGCCACACTGCTGCGCGCG
CTGTGCCCGTCCAACGCCAACTCGTCCACGCCCACGACCACGGTGATCGACCCCAGCACGCCGGCGGTGCTGGACAACAACTACTACAAGCTGCTGCCGCTCAACCTGGGCCTCTTCTTC
TCCGACAACCAGCTGCGCGTCAACTCCACGCTCAACGCCTCCGTCAACAGCTTCGCCGCCAACGAGACGCTCTGGAAGGAGAAGTTCGTCGCCGCCATGGTCAAGATGGGAAACATCCAG
GTGCTCACGGGGACCCAGGGCCAGATCAGGCTCAACTGCAGCATCGTCAACAACGGCTCGTCGTCGGTGGGGATCCAGCAGATGACAGTGCCCAACTCCTACTCTGGCGCCACCGCGTCC
CTTGATGATGAGATCGCCACGAGCTGA

Retrieve as FASTA