Entry information : AcoPrx[P]105
Entry ID 9972
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-01-12 (Christophe Dunand)
Peroxidase information: AcoPrx[P]105
Name AcoPrx[P]105
Class Class III peroxidase     [Orthogroup: Prx029]*
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx[P]105
start..stop
S start..stop
AcoPrx76 244 4e-83 1..132 1..132
AfpPrx05 158 6e-49 26..132 45..151
AcoPrx16 158 6e-49 26..132 45..151
GhPrx37 154 2e-47 4..132 5..144
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 589939..590142 204 N° 2 589276..589467 192  
complement(join(589276..589467,589939..590142))


exon

Literature and cross-references AcoPrx[P]105
DNA ref. Phytozome 12:   scaffold_70 (590142..589276)
Protein sequence: AcoPrx[P]105
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   130 (111)
PWM (Da):   %s   13982.68 (11871.7)  
PI (pH):   %s   4.27 (4.27) Peptide Signal:   %s   cut: 20 range:20-130
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSMYFFCCLMVLVLGQANSMLSADFYHTSC*EAESIIMSTMSQAFKRDPTLAASLLLLHFHDCFVQGCDASVLLDDTELHAGEKTALPNDQSL*GFEVIDTIKAELEKACPRTVSCSDVIAAVARDSVVL

Retrieve as FASTA  
Remarks Pseudogene from genomic (Stops in frame; Long 3' end is missing). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCATCAATGTATTTCTTCTGTTGCTTAATGGTACTGGTTCTTGGTCAGGCCAACTCCATGTTAAGTGCAGACTTCTACCATACTTCATGCTGAGAAGCTGAATCAATCATAATG
TCTACAATGTCTCAAGCTTTTAAGCGAGATCCAACCCTGGCAGCATCGCTTTTACTGTTGCATTTCCATGATTGCTTTGTTCAG
GTTAGCATAAGTATTATCCTAAGTTTTAAGTTATGA
TTTGAAATATTTCATCTCAAGTGTTTTGTAAAGGTGTGTCCATGACTTCATTCTGCTTGCTCAGAGGTTTTTGTGTGACTGATCTGTTACCTGCAACTGTGAAACTCCCTTAGGGAATCA
CAATATAGCACCTCTGATCAGAAGCTAATTGGTTTCATTTTGGCGTGATTTCTGCATTCAATGTTTATAGTATGTGTATTTGAATTTATTCGGCAAATAGATCATTAAGCTGGTCGTTTA
CGAGGCCATTGTTGGTTGCAATACTTCTTTATTCCTATTTGTCATCTGCAACATATAAAATGAATTGCTCTGACTAATCATAATAGAAAATTGTTTATCATTCCTCCTTAAACTAGTTAT
ACTTTCATTGTGCAGATCGAGTTTATGTGAAATAACAATGGGATTATATTTGTTCTAATAACTTGGTTTTCACAGGGCTGTGATGCATCCGTTCTTTTGGATGATACAGAACTCCATGCC
GGGGAAAAGACAGCACTGCCTAACGATCAGTCTCTCTGAGGATTTGAGGTCATAGACACCATCAAGGCTGAACTAGAAAAGGCTTGCCCTCGCACAGTTTCATGCTCAGATGTCATTGCA
GCAGTAGCAAGGGACTCTGTGGTTCTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCATCAATGTATTTCTTCTGTTGCTTAATGGTACTGGTTCTTGGTCAGGCCAACTCCATGTTAAGTGCAGACTTCTACCATACTTCATGCTGAGAAGCTGAATCAATCATAATG
TCTACAATGTCTCAAGCTTTTAAGCGAGATCCAACCCTGGCAGCATCGCTTTTACTGTTGCATTTCCATGATTGCTTTGTTCAG
GGCTGTGATGCATCCGTTCTTTTGGATGATACAGAA
CTCCATGCCGGGGAAAAGACAGCACTGCCTAACGATCAGTCTCTCTGAGGATTTGAGGTCATAGACACCATCAAGGCTGAACTAGAAAAGGCTTGCCCTCGCACAGTTTCATGCTCAGAT
GTCATTGCAGCAGTAGCAAGGGACTCTGTGGTTCTG

Retrieve as FASTA