Entry information : AcoPrx106
Entry ID 9973
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx106
Name AcoPrx106
Class Class III peroxidase    [Orthogroup: Prx134]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx106
start..stop
S start..stop
AcoPrx72 596 0 1..319 1..319
AcoPrx94 556 0 1..308 1..307
AcoPrx65 553 0 1..319 1..315
AcoPrx[P]81 518 0 1..319 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2540417..2540641 225 N° 2 2540190..2540306 117 N° 3 2540049..2540108 60 N° 4 2539458..2540015 558
complement(join(2539458..2540015,2540049..2540108,2540190..2540306,2540417..2540 641))


exon

Literature and cross-references AcoPrx106
DNA ref. Phytozome 12:   scaffold_3 (2540641..2539458)
Protein sequence: AcoPrx106
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (291)
PWM (Da):   %s   34043.98 (31282.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.72 (8.72) Peptide Signal:   %s   cut: 29 range:29-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSTSSVLSIGLVMVLLTTFSLPAALAQLSVSYYASTCPSVFDTVRSATRSVINRDGRMGASILCLFFHDCFVSGCDGGILLSGGERNAPGNIAMVRGYDVIDSIKAQVDRACGNIIYSYIVYAPIYIVNNIIQLGGPSYAVPLGRRDTRTPNIAGARSDLPAFFHDLPRIINIFQGKGFSEREMVALSGAHSIGQARCSSFRDRIYSNTSNIDPAFAVSRQATCPRSGGDGNLAPLDPQSPGRFGNNYFQALMNRRGLLNSDQVLFNGGSTDSIVRTYANAASAFSTDFMNAMVKMGNLSPLTGTQGEIRTTCQRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGCAGTACTAGTTCAGTTCTCTCAATAGGTCTTGTTATGGTCCTTTTAACCACCTTTTCCTTACCAGCTGCTTTAGCACAGCTTTCAGTCTCCTACTATGCCAGTACATGCCCA
TCAGTTTTTGATACTGTTCGGTCAGCCACACGGTCTGTCATCAATAGAGATGGTCGAATGGGTGCTTCCATTTTATGTCTATTTTTTCATGATTGTTTTGTTAGT
GTAAGTTCATTTTCT
TACTCAAAATGGTTTATATTGTCGTCTTAATTATATATAATTATGTTAAGTAGTATTTATGATCTAATTAAGGTGCATTGCTTTCATGGCTTCAGGGTTGTGATGGAGGAATTCTATTGT
CTGGCGGTGAAAGAAATGCCCCAGGCAATATTGCTATGGTAAGAGGGTATGATGTTATTGATAGCATAAAGGCACAGGTTGATAGAGCATGC
CATTAGTAGCCGAGACTCCATTGTCCAA
GTAAGTAAACTAATTACTGGTGTATATTAAATGAACTTAGATAAATGGAATTTGGAAACATAATATATTCCTATATTGTATATGCTCCTATCTATATTGTTAATAATATAATATAATAAC
CAACATTTCATTCTTTGTTTTTATCTCAGCTTGGAGGACCGAGTTATGCAGTTCCATTAGGAAGGAGAGATACAAGAACACCAAACATTGCAGGAGCAAGAAGCGATCTCCCCGCCTTCT
TTCACGATCTTCCAAGGATCATAAACATATTTCAAGGCAAAGGCTTTAGTGAACGAGAAATGGTAGCTTTATCTGGAGCACACTCAATAGGCCAAGCTCGATGCTCTTCTTTTAGAGATC
GAATCTATAGTAATACTAGCAACATTGATCCCGCATTCGCAGTGTCTAGGCAGGCTACTTGTCCTCGTAGTGGTGGAGATGGAAACTTAGCACCACTAGACCCTCAAAGCCCAGGTCGTT
TTGGAAACAATTATTTCCAGGCATTGATGAACAGAAGAGGACTTCTTAACTCAGATCAGGTGTTGTTTAACGGTGGCTCGACCGATTCTATTGTAAGGACATATGCCAATGCTGCTAGTG
CCTTTTCAACAGATTTCATGAATGCAATGGTTAAAATGGGGAACTTAAGTCCCTTAACTGGTACTCAAGGCGAGATACGCACAACTTGTCAAAGGGTAAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGCAGTACTAGTTCAGTTCTCTCAATAGGTCTTGTTATGGTCCTTTTAACCACCTTTTCCTTACCAGCTGCTTTAGCACAGCTTTCAGTCTCCTACTATGCCAGTACATGCCCA
TCAGTTTTTGATACTGTTCGGTCAGCCACACGGTCTGTCATCAATAGAGATGGTCGAATGGGTGCTTCCATTTTATGTCTATTTTTTCATGATTGTTTTGTTAGT
GGTTGTGATGGAGGA
ATTCTATTGTCTGGCGGTGAAAGAAATGCCCCAGGCAATATTGCTATGGTAAGAGGGTATGATGTTATTGATAGCATAAAGGCACAGGTTGATAGAGCATGC
GGAAACATAATATATTCC
TATATTGTATATGCTCCTATCTATATTGTTAATAATATAATA
CAGCTTGGAGGACCGAGTTATGCAGTTCCATTAGGAAGGAGAGATACAAGAACACCAAACATTGCAGGAGCAAGAAGC
GATCTCCCCGCCTTCTTTCACGATCTTCCAAGGATCATAAACATATTTCAAGGCAAAGGCTTTAGTGAACGAGAAATGGTAGCTTTATCTGGAGCACACTCAATAGGCCAAGCTCGATGC
TCTTCTTTTAGAGATCGAATCTATAGTAATACTAGCAACATTGATCCCGCATTCGCAGTGTCTAGGCAGGCTACTTGTCCTCGTAGTGGTGGAGATGGAAACTTAGCACCACTAGACCCT
CAAAGCCCAGGTCGTTTTGGAAACAATTATTTCCAGGCATTGATGAACAGAAGAGGACTTCTTAACTCAGATCAGGTGTTGTTTAACGGTGGCTCGACCGATTCTATTGTAAGGACATAT
GCCAATGCTGCTAGTGCCTTTTCAACAGATTTCATGAATGCAATGGTTAAAATGGGGAACTTAAGTCCCTTAACTGGTACTCAAGGCGAGATACGCACAACTTGTCAAAGGGTAAATTAG

Retrieve as FASTA