Entry information : TvGPx01
Entry ID 9974
Creation 2011-12-14 (Passaia Gisèle)
Last sequence changes 2012-04-06 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-23 (Achraf Jemmat)
Peroxidase information: TvGPx01
Name TvGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvGPx01
start..stop
S start..stop
GsppGPx01 307 2e-107 7..229 14..233
DsGPx01 305 3e-106 7..229 24..237
ParcGPx01 293 7e-103 73..229 5..161
BaGPx01 294 2e-102 9..229 3..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1322917..1323233 317 N° 2 1322544..1322808 265 N° 3 1322363..1322470 108  
complement(join(1322363..1322470,1322544..1322808,1322917..1323233))


exon

Literature and cross-references TvGPx01
DNA ref. JGI genome:   scaffold_7 (1323233..1322363)
Cluster/Prediction ref. JGI gene:   124939
Protein sequence: TvGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   230
PWM (Da):   %s   25574.32  
PI (pH):   %s   10.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHRAPAPLAHRYISRATLSPRPSALARPHHYLALSHHLARSSARSPTRLIRSPPHLSRTFSSSKQSAMSDAKSFYELSASLPGGKTYKFEELKGKVVLIVNVASKCGFTPQYKGLQALYDKHKEKGFVILGFPCNQFGGQEPENDEKIAQFCELNHGVSFPLMAKSDVNGDATNEVYKWLKGQKAGILGLTRIWNFEKFLIDREGKVVHRWASTTSPEAIDTEVEKLL*

Retrieve as FASTA  
Remarks Conplete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCGCGCCCCCGCCCCCCTGGCTCATCGATATATTTCTCGTGCCACACTTAGTCCGCGCCCGTCCGCTCTCGCACGCCCGCACCACTATCTTGCGCTCTCCCACCACCTCGCACGC
TCATCCGCACGCTCGCCGACGCGTCTTATCCGCTCACCACCACATCTCAGCCGCACCTTCAGCAGCTCTAAGCAATCAGCCATGTCCGACGCAAAGTCCTTCTACGAGCTCTCCGCGTCC
CTCCCGGGCGGGAAGACGTACAAGTTCGAGGAGCTCAAGGGCAAGGTCGTCCTCATCGTCAACGTTGCATCCAAGTG
GTACGTCCCCCATCCTTGCCCCCCCCCTCCCAACCTCCTCTTC
CCTCCCTGCCTCTATCCCGCATCCCCGCGTCCCCACATACTAACGCGGTGCGTCTGCCCCTCCAGCGGGTTCACGCCGCAGTACAAGGGCCTGCAGGCGCTGTACGACAAGCACAAGGAG
AAGGGCTTCGTCATCCTCGGCTTCCCGTGCAACCAGTTCGGCGGGCAGGAGCCCGAGAACGACGAGAAGATCGCGCAGTTCTGCGAGCTCAACCACGGCGTCTCCTTCCCCCTCATGGCC
AAGTCCGACGTCAACGGCGACGCCACGAACGAGGTCTACAAGTGGCTCAAGGGCCAGAAGGCCGGCATCCTCGGCCTCACCCGCATCAAG
GTGCGTTTGTTTCCTGTGTGGTGTTGAGGG
GGCAAGGGGACTGGAACTGGGACTGACGACGGGATGCGTACAGTGGAACTTTGAGAAGTTCCTGATCGACCGCGAGGGCAAGGTCGTCCACCGCTGGGCGTCGACGACGTCCCCCGAGGC
GATCGACACCGAGGTCGAGAAGCTCCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCGCGCCCCCGCCCCCCTGGCTCATCGATATATTTCTCGTGCCACACTTAGTCCGCGCCCGTCCGCTCTCGCACGCCCGCACCACTATCTTGCGCTCTCCCACCACCTCGCACGC
TCATCCGCACGCTCGCCGACGCGTCTTATCCGCTCACCACCACATCTCAGCCGCACCTTCAGCAGCTCTAAGCAATCAGCCATGTCCGACGCAAAGTCCTTCTACGAGCTCTCCGCGTCC
CTCCCGGGCGGGAAGACGTACAAGTTCGAGGAGCTCAAGGGCAAGGTCGTCCTCATCGTCAACGTTGCATCCAAGTG
CGGGTTCACGCCGCAGTACAAGGGCCTGCAGGCGCTGTACGAC
AAGCACAAGGAGAAGGGCTTCGTCATCCTCGGCTTCCCGTGCAACCAGTTCGGCGGGCAGGAGCCCGAGAACGACGAGAAGATCGCGCAGTTCTGCGAGCTCAACCACGGCGTCTCCTTC
CCCCTCATGGCCAAGTCCGACGTCAACGGCGACGCCACGAACGAGGTCTACAAGTGGCTCAAGGGCCAGAAGGCCGGCATCCTCGGCCTCACCCGCATCAAG
TGGAACTTTGAGAAGTTC
CTGATCGACCGCGAGGGCAAGGTCGTCCACCGCTGGGCGTCGACGACGTCCCCCGAGGCGATCGACACCGAGGTCGAGAAGCTCCTCTGA

Retrieve as FASTA