Entry information : PcarPrxQ02
Entry ID 9975
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-12-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PcarPrxQ02
Name PcarPrxQ02
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarPrxQ02
start..stop
S start..stop
PcPrxQ02 374 2e-134 1..215 1..218
PplPrxQ02 257 1e-87 4..214 15..214
LbiPrxQ02 250 5e-85 5..214 16..213
AmusPrxQ 243 4e-82 2..214 16..236
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1181695..1181820 126 N° 2 1181515..1181620 106 N° 3 1181323..1181457 135 N° 4 1181152..1181273 122
N° 5 1180943..1181101 159  
complement(join(1180943..1181101,1181152..1181273,1181323..1181457,1181515..1181 620,1181695..1181820))


exon

Literature and cross-references PcarPrxQ02
DNA ref. JGI genome:   scaffold_7 (1181820..1180943)
Protein sequence: PcarPrxQ02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   215
PWM (Da):   %s   23081.82  
PI (pH):   %s   7.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAETRRSSRIAAQPKKDELPKPVRNPTKKRSTGEEDGPAAKKAKNEEQPTETQEGEQPADASVGDARVEGAQSQADNAVKPIDIGDTLPSLTLKNEQGEDVDVSTLTVEKGVIMFLIPKADTPGCTTQACGFRDAYPNFTEVGYDVYCLSADSPAAQSKWQSKELPYPLLSDPKRVLITALGAGEGGKTKRSHFIFEKGGKLIKKELPVKPADR*

Retrieve as FASTA  
Remarks complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGAGACACGCCGCTCCTCGCGCATTGCAGCGCAACCCAAGAAAGACGAACTTCCGAAACCTGTGCGCAACCCCACAAAGAAGAGGTCGACTGGTGAGGAGGACGGCCCCGCCGCC
AAGAAG
GTTGGTGTCGCACTGTCAACGAACGGAACACTGTGCTGTTTGTGTTTGTGTTAATATGTTGAGCCATCTCACAGGCCAAGAACGAGGAGCAGCCCACTGAAACTCAGGAGGGCG
AGCAGCCTGCGGATGCAAGTGTTGGGGACGCCAGGGTAGAGGGAGCACAGTCACAAGCGGACAACG
GCGAGTGTTTTCCTGATCTCTACATTTTTTAGATATCAAATTAAGTCCAATATA
TAGCTGTGAAGCCGATTGACATTGGCGACACTCTGCCCTCTCTGACTCTCAAGAACGAACAGGGTGAAGACGTCGATGTATCCACGCTCACCGTCGAGAAGGGAGTTATTATGTTCTTGA
TTCCTAAAGCTGACACTC
GTACGTACTTTCTTCTCATCTGTGAACCCAAGACCTATAATATGAGCAGCCGGATGCACTACTCAGGCGTGCGGCTTCCGCGACGCGTATCCCAACTTCACC
GAGGTCGGCTATGACGTGTACTGCCTGAGCGCAGATAGCCCGGCTGCCCAGAGCAAGTGGCAGTCCAAG
GTGCGTATTTTTGGGTGGCTTCCGTAGCATGTATTGATCTCGGCGAGCAGA
AGGAGCTTCCGTACCCTTTGCTATCCGACCCTAAACGTGTCCTCATTACGGCGCTCGGTGCGGGTGAAGGCGGAAAGACCAAGCGCAGCCACTTCATTTTTGAGAAGGGCGGCAAGCTCA
TTAAGAAGGAGCTGCCAGTGAAGCCCGCTGATAGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGAGACACGCCGCTCCTCGCGCATTGCAGCGCAACCCAAGAAAGACGAACTTCCGAAACCTGTGCGCAACCCCACAAAGAAGAGGTCGACTGGTGAGGAGGACGGCCCCGCCGCC
AAGAAG
GCCAAGAACGAGGAGCAGCCCACTGAAACTCAGGAGGGCGAGCAGCCTGCGGATGCAAGTGTTGGGGACGCCAGGGTAGAGGGAGCACAGTCACAAGCGGACAACGCTGTGAAG
CCGATTGACATTGGCGACACTCTGCCCTCTCTGACTCTCAAGAACGAACAGGGTGAAGACGTCGATGTATCCACGCTCACCGTCGAGAAGGGAGTTATTATGTTCTTGATTCCTAAAGCT
GACACTC
CCGGATGCACTACTCAGGCGTGCGGCTTCCGCGACGCGTATCCCAACTTCACCGAGGTCGGCTATGACGTGTACTGCCTGAGCGCAGATAGCCCGGCTGCCCAGAGCAAGTGG
CAGTCCAAG
AAGGAGCTTCCGTACCCTTTGCTATCCGACCCTAAACGTGTCCTCATTACGGCGCTCGGTGCGGGTGAAGGCGGAAAGACCAAGCGCAGCCACTTCATTTTTGAGAAGGGC
GGCAAGCTCATTAAGAAGGAGCTGCCAGTGAAGCCCGCTGATAGGTAA

Retrieve as FASTA