Entry information : PcarPrxII
Entry ID 9978
Creation 2011-12-14 (Christophe Dunand)
Last sequence changes 2011-12-14
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PcarPrxII
Name PcarPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)     [Orthogroup: PrxII001]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarPrxII
start..stop
S start..stop
PcPrxII 290 2e-102 1..162 12..173
AthiPrxII 199 2e-66 2..162 15..172
SlutPrxII01 196 2e-65 2..162 15..172
SbrePrxII01 196 2e-65 2..162 15..172
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2988..3051 64 N° 2 2862..2932 71 N° 3 2663..2809 147 N° 4 2468..2611 144
N° 5 2349..2411 63  
complement(join(2349..2411,2468..2611,2663..2809,2862..2932,2988..3051))


exon

Literature and cross-references PcarPrxII
DNA ref. JGI genome:   scaffold_255 (3051..2349)
Protein sequence: PcarPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   16980.75  
PI (pH):   %s   5.17
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGKFATVYYTPELDSHAACGAPSKVTTDIFKGKKVVIFAVPGAFPSCHANHLPPFAEKYNELKSKGVDDVYVLSANDPFVLSGWTRIQGVADKIVGLTDIEGAWSKELGLTVDLSAAGIGLGTRTTRYALCLDDLKVTYLGVEPDPTQVTVSGAEAVLAAL*

Retrieve as FASTA  
Remarks First AA are missing => undetermined nucleotide). Partail sequence also detecetd in scaffold_615.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTGGCAAGTTCGCGACCGTGTACTACACGCCCGAGCTCGATTCGCACGCCGCTTGCGGTGCCCGTATGTAGTACCCCCACACAGAACGACGATGGATACTGATATCGAGCGTGCCCAGC
CTCCAAGGTGACCACGGACATCTTCAAGGGCAAGAAGGTCGTTATCTTTGCCGTTCCGGGAGCCTTCACG
GTGGGTGATTAGCGCCGATGCGTCTTCGCTTCCCCTCTGATGTTTGCTAC
AGCCATCGTGCCATGCGAACCACCTGCCGCCGTTTGCGGAGAAGTACAATGAGCTCAAATCCAAAGGCGTCGACGACGTCTACGTCTTGTCAGCCAACGATCCCTTCGTGCTCAGCGGCT
GGACCCGTATTCAGGGTGTTGCTGACAAG
GTGCGTAAACAGTGCTGCATTGGAACGGCACTGTACTGATGGCGAGTCCAGATCGTCGGCCTCACGGACATTGAAGGTGCCTGGTCAAAGG
AGCTTGGCCTGACCGTGGACCTTAGTGCCGCTGGCATCGGCCTCGGCACGCGTACCACTCGCTACGCGCTCTGCCTGGACGACCTCAAGGTCACATACCTCGGC
GTACGTACTATCTTTC
GCCACCTCGCAGAATCGATTGTCTGACCATCAATGCACAGGTCGAGCCGGACCCGACTCAAGTCACTGTCTCTGGCGCTGAAGCCGTCCTTGCCGCGCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTGGCAAGTTCGCGACCGTGTACTACACGCCCGAGCTCGATTCGCACGCCGCTTGCGGTGCCCCCTCCAAGGTGACCACGGACATCTTCAAGGGCAAGAAGGTCGTTATCTTTGCCGTT
CCGGGAGCCTTCACG
CCATCGTGCCATGCGAACCACCTGCCGCCGTTTGCGGAGAAGTACAATGAGCTCAAATCCAAAGGCGTCGACGACGTCTACGTCTTGTCAGCCAACGATCCCTTC
GTGCTCAGCGGCTGGACCCGTATTCAGGGTGTTGCTGACAAG
ATCGTCGGCCTCACGGACATTGAAGGTGCCTGGTCAAAGGAGCTTGGCCTGACCGTGGACCTTAGTGCCGCTGGCATC
GGCCTCGGCACGCGTACCACTCGCTACGCGCTCTGCCTGGACGACCTCAAGGTCACATACCTCGGC
GTCGAGCCGGACCCGACTCAAGTCACTGTCTCTGGCGCTGAAGCCGTCCTTGCC
GCGCTCTGA

Retrieve as FASTA