Entry information : SiAPx[P]09
Entry ID 9986
Creation 2011-12-14 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiAPx[P]09
Name SiAPx[P]09
Class Ascorbate peroxidase     [Orthogroup: APx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiAPx[P]09
start..stop
S start..stop
SiAPx06 290 1e-100 1..142 27..168
HvAPx05 261 2e-89 1..142 27..169
ZmAPx06 261 3e-89 1..142 28..170
TaAPx03 258 4e-88 1..142 28..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24019581..24019697 117 N° 2 24020115..24020235 121 N° 3 24020309..24020409 101 N° 4 24020502..24020594 93
join(24019581..24019697,24020115..24020235,24020309..24020409,24020502..24020594 )


exon

Literature and cross-references SiAPx[P]09
DNA ref. Phytozome 11:   scaffold_3 (24019581..24020594)
Protein sequence: SiAPx[P]09
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   143
PWM (Da):   %s   15195.88  
PI (pH):   %s   7.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QELGRRPLSSAAGDAAAELRGAREDVKQLLKTTSCHPILVRLGWHDAGTYDKNIAEWPKCGGANGSLRFEIELKHGANAGLVNASKLIQPIKDKFSGVTYADLFQLASATAIEAGGPKIPMIYGRIDITAPEQCPPEGRLPG*

Retrieve as FASTA  
Remarks Pseudogene from genomic (Both 5' and 3' ends are missing which is located in the intron of 9552: SiPrx57 (Si011734m)). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGAGCTCGGGCGGCGTCCGTTGAGCTCGGCGGCAGGGGATGCGGCGGCCGAGCTGAGGGGCGCGCGGGAGGACGTCAAGCAGCTGCTCAAGACCACTTCCTGCCATCCCATTCTGGTA
CGGTATTTCTCCTCCTGCAAATTCCTAGGCTCCATATGGGTTGAGCAGACAAGAATTCCTAGGCTCCACGGTAGGGGGCATCTCCCCCTCCGGTCGCGGTTTTTTTTTGGGTTGAGCAGA
CAAGTGATTGTGTTCGGCTTGATGGAAATCTGCATCTGTACAAAAGTTAAGTTTTTTTTTTCTCACGTTTCGTGCAATTGATGAACCAATACTGCGTCCTTTTGTTTTGGGTAAGGAACG
GACTCGTGCGATTTAGTTGGCAGATGTACTGGTCTGTTTATGCTAGATCAATTTTGATCTTTGTGCTTTGTGTGCACTATTTTTTGCATCTTCTCGATTCAGCATTAGATGATTCAGCCT
TTGAGTTGCCTAGATACGAGTATGGCTTTTGTGATGTTTTATCGTTTGGTTCAGGTTCGATTGGGTTGGCATGATGCTGGTACCTATGACAAGAACATTGCTGAGTGGCCCAAGTGCGGT
GGAGCTAATGGTAGCTTGAGATTTGAAATTGAGTTAAAGCACGGGGCTAATGCTG
GTAGTGCTTCTCCTCCATTAATCATCTGTAGCTTCATGATGAATTGCCATTCTTATATTTAGTTC
TGCGACAGGTCTTGTGAATGCTTCTAAGCTGATCCAACCGATCAAGGACAAGTTTTCAGGTGTCACATATGCAGATCTCTTTCAGCTTGCGAGTGCCACAGCCATTGAGGTCTGTTATTG
TACTTCAGCTTTAAGTGAGATGATTGTTGGAAAATGCTTCTTGTTAATAATGACTGGATGTTTTGATTTCTTTCATTTCAGGAAGCTGGTGGCCCCAAAATTCCCATGATCTATGGAAGG
ATTGACATTACTGCCCCTGAACAATGCCCACCAGAGGGGAGGCTTCCTGGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGAGCTCGGGCGGCGTCCGTTGAGCTCGGCGGCAGGGGATGCGGCGGCCGAGCTGAGGGGCGCGCGGGAGGACGTCAAGCAGCTGCTCAAGACCACTTCCTGCCATCCCATTCTGGTT
CGATTGGGTTGGCATGATGCTGGTACCTATGACAAGAACATTGCTGAGTGGCCCAAGTGCGGTGGAGCTAATGGTAGCTTGAGATTTGAAATTGAGTTAAAGCACGGGGCTAATGCTG
GT
CTTGTGAATGCTTCTAAGCTGATCCAACCGATCAAGGACAAGTTTTCAGGTGTCACATATGCAGATCTCTTTCAGCTTGCGAGTGCCACAGCCATTGAG
GAAGCTGGTGGCCCCAAAATT
CCCATGATCTATGGAAGGATTGACATTACTGCCCCTGAACAATGCCCACCAGAGGGGAGGCTTCCTGGTTAG

Retrieve as FASTA