Entry information : NtetGPx01_2509
Entry ID 9987
Creation 2011-12-14 (Passaia Gisèle)
Last sequence changes 2012-05-30 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-23 (Christophe Dunand)
Peroxidase information: NtetGPx01_2509
Name NtetGPx01_2509
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora tetrasperma    [TaxId: 40127 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NtetGPx01_2509
start..stop
S start..stop
NcGPx01 456 4e-166 1..227 1..229
SmaGPx01 380 4e-136 1..227 1..224
NdisGPx01 340 4e-121 61..227 1..167
StheGPx01 297 3e-103 28..227 36..237
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4444444..4444666 223 N° 2 4443904..4444364 461  
complement(join(4443904..4444364,4444444..4444666))


exon

Literature and cross-references NtetGPx01_2509
DNA ref. JGI genome:   scaffold_2 (4444666..4443904)
Protein sequence: NtetGPx01_2509
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   228
PWM (Da):   %s   25734.41  
PI (pH):   %s   9.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIPRYHHRSVATLARTSLTTRHLKLSPILSQQQQPRLPVSKPAFRCQPAISRRFATTTLNMSSATTIYDFKPLDKKGSELPLSTYQGKVVLIVNVASKCGFTPQYAGLEKVYKEIKEKYPDDFEILAFPCNQFGGQEPGTEEEIQSFCQLNYGVSFPIMKKVEVNGDNADPLYEWMKNEKPGLMGLKRIKWNFEKFLIGKDGKVKGRWASTTKPESLKEAILKELGE

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_2). Strain "FGSC 2509 mat a"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCCCGCTACCATCATCGCTCAGTAGCTACACTTGCTCGCACCTCACTCACCACTCGTCATTTGAAACTATCACCGATTCTATCTCAACAACAACAACCTCGACTGCCAGTTTCC
AAACCAGCATTCCGTTGCCAGCCAGCTATTTCCAGACGCTTCGCAACAACCACACTCAACATGTCTTCTGCCACTACTATCTACGACTTTAAGCCCCTTGACA
GTAAGCCCTCGCCCCTC
TTTATCTTAGTCTCTCACCACCACCACATCATCATCACCACCCATACTAACCAAACCCACAGAGAAGGGCTCCGAACTCCCCCTCTCCACCTACCAAGGCAAGGTAGTCCTGATCGTCAA
CGTTGCCTCCAAATGCGGCTTCACGCCTCAATACGCCGGCTTGGAAAAGGTCTACAAGGAGATCAAGGAGAAGTACCCGGACGATTTTGAGATCCTCGCTTTCCCTTGCAACCAGTTCGG
CGGACAGGAGCCGGGCACCGAGGAGGAGATCCAGTCGTTCTGCCAGCTCAACTATGGCGTTTCCTTCCCAATCATGAAGAAGGTGGAGGTCAACGGCGACAATGCTGATCCCCTCTATGA
GTGGATGAAGAATGAGAAGCCTGGCCTGATGGGATTGAAGAGAATCAAGTGGAACTTTGAAAAGTTCTTGATTGGAAAGGACGGAAAGGTCAAGGGACGGTGGGCGAGCACTACGAAGCC
TGAGAGTCTGAAGGAGGCTATCCTCAAGGAGTTGGGCGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCCCGCTACCATCATCGCTCAGTAGCTACACTTGCTCGCACCTCACTCACCACTCGTCATTTGAAACTATCACCGATTCTATCTCAACAACAACAACCTCGACTGCCAGTTTCC
AAACCAGCATTCCGTTGCCAGCCAGCTATTTCCAGACGCTTCGCAACAACCACACTCAACATGTCTTCTGCCACTACTATCTACGACTTTAAGCCCCTTGACA
AGAAGGGCTCCGAACTC
CCCCTCTCCACCTACCAAGGCAAGGTAGTCCTGATCGTCAACGTTGCCTCCAAATGCGGCTTCACGCCTCAATACGCCGGCTTGGAAAAGGTCTACAAGGAGATCAAGGAGAAGTACCCG
GACGATTTTGAGATCCTCGCTTTCCCTTGCAACCAGTTCGGCGGACAGGAGCCGGGCACCGAGGAGGAGATCCAGTCGTTCTGCCAGCTCAACTATGGCGTTTCCTTCCCAATCATGAAG
AAGGTGGAGGTCAACGGCGACAATGCTGATCCCCTCTATGAGTGGATGAAGAATGAGAAGCCTGGCCTGATGGGATTGAAGAGAATCAAGTGGAACTTTGAAAAGTTCTTGATTGGAAAG
GACGGAAAGGTCAAGGGACGGTGGGCGAGCACTACGAAGCCTGAGAGTCTGAAGGAGGCTATCCTCAAGGAGTTGGGCGAGTAA

Retrieve as FASTA