Entry information : HpulGPx01
Entry ID 10000
Creation 2011-12-14 (Passaia Gisèle)
Last sequence changes 2011-12-14 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-10-15 (Catherine Mathe (Scipio))
Peroxidase information: HpulGPx01
Name HpulGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Hysteriaceae Hysterium
Organism Hysterium pulicare    [TaxId: 100027 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HpulGPx01
start..stop
S start..stop
LpaluGPx01 307 4.54e-107 52..223 62..233
RrufGPx01 298 8e-105 71..225 13..167
GsteGPx01 293 1.29e-102 57..222 1..166
LfluGPx01 293 8.23e-102 27..223 40..232
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10000' 'complement(join(83912..84259,84353..84468,84531..84741))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 84531..84741 209 N° 2 84353..84468 114 N° 3 83912..84259 346  
complement(join(83912..84259,84353..84468,84531..84741))


exon

Literature and cross-references HpulGPx01
DNA ref. JGI genome:   NODE_1139_length_110822_cov_26.160645 (84741..83912)
Protein sequence: HpulGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   25405.15  
PI (pH):   %s   10.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLPTRFFLCTASRALISRHLTFLRATTHSWNSPLSIKKHPFLLHQANISRSYQTGTMSSATTIYDFKPKDKRGKEYPTANLKNRVVLIVNTASKCGFTPQFKGLEKLYKDISAQHPEFTI
IGFPCNQFGNQDPGTNDEIQEFCQVNYGVSFPILGKIDVNGDNADPLYEWMKGEKPGLMGLKRIKWNFEKFLIGRDGKVKARWASTTKPEQLKDAIEKELATKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCCCACTCGGTTCTTTCTTTGCACCGCCTCCCGCGCTCTCATCTCAAGGCATCTCACTTTCCTAAGAGCAACTACTCACAGCTGGAATTCTCCATTGAGCATCAAGAAACACCCG
TTTTTACTACACCAAGCGAATATTTCGAGAAGCTATCAAACAGGAACCATGTCATCTGCGACGACAATTTACGACTTTAAGCCCAAGGACA
GTGAGTCTCTTTTCCCCCAAGCACATCAC
TTGTTATGACTCCGCTGAACACTTTTCAACCAGAGAGAGGGGCAAGGAGTATCCTACGGCGAATCTCAAGAACAGGGTTGTTCTTATCGTGAATACTGCCTCCAAGTGCGGTTTCACACC
TCAATTCAAAGGACTGGAGAAGCTGTATAAG
GTATCGCCCTTGCTCAATAAACCTTTTTCAAGCTCCTATCACCTACAGTAATACCAGTGACAGCCAGCTAACCTTATATTCTCCTTCCG
GTAGGAGACATCAGTGCCCAACATCCTGAATTCACCATCATCGGCTTCCCTTGCAACCAATTCGGCAATCAAGATCCCGGCACCAACGACGAGATCCAAGAGTTCTGCCAGGTCAACTAC
GGCGTCTCATTCCCTATCCTCGGCAAGATCGATGTAAATGGAGACAATGCAGACCCATTGTACGAGTGGATGAAGGGCGAGAAGCCAGGCCTCATGGGCTTGAAAAGAATCAAATGGAAC
TTCGAGAAGTTCTTGATCGGAAGAGACGGAAAGGTCAAGGCAAGATGGGCGAGCACTACAAAGCCGGAACAGCTGAAGGATGCTATCGAGAAGGAGTTGGCTACGAAAGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCCCACTCGGTTCTTTCTTTGCACCGCCTCCCGCGCTCTCATCTCAAGGCATCTCACTTTCCTAAGAGCAACTACTCACAGCTGGAATTCTCCATTGAGCATCAAGAAACACCCG
TTTTTACTACACCAAGCGAATATTTCGAGAAGCTATCAAACAGGAACCATGTCATCTGCGACGACAATTTACGACTTTAAGCCCAAGGACA
AGAGGGGCAAGGAGTATCCTACGGCGAAT
CTCAAGAACAGGGTTGTTCTTATCGTGAATACTGCCTCCAAGTGCGGTTTCACACCTCAATTCAAAGGACTGGAGAAGCTGTATAAG
GACATCAGTGCCCAACATCCTGAATTCACCATC
ATCGGCTTCCCTTGCAACCAATTCGGCAATCAAGATCCCGGCACCAACGACGAGATCCAAGAGTTCTGCCAGGTCAACTACGGCGTCTCATTCCCTATCCTCGGCAAGATCGATGTAAAT
GGAGACAATGCAGACCCATTGTACGAGTGGATGAAGGGCGAGAAGCCAGGCCTCATGGGCTTGAAAAGAATCAAATGGAACTTCGAGAAGTTCTTGATCGGAAGAGACGGAAAGGTCAAG
GCAAGATGGGCGAGCACTACAAAGCCGGAACAGCTGAAGGATGCTATCGAGAAGGAGTTGGCTACGAAAGCATAA

Retrieve as FASTA