Entry information : MlpGPx01
Entry ID 10013
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-10 (Christophe Dunand)
Peroxidase information: MlpGPx01
Name MlpGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Melampsoraceae Melampsora
Organism Melampsora laricis-populina    [TaxId: 203908 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MlpGPx01
start..stop
S start..stop
CqueGPx01 301 9.47e-107 1..168 1..168
PgrGPx01 256 2.98e-88 6..163 53..210
PUtriGPx01 246 9.79e-85 4..165 22..183
PbreGPx01 235 6.85e-80 1..161 65..225
Gene structure Fichier Exons


exon

Literature and cross-references MlpGPx01
DNA ref. JGI genome:   scaffold_42 (343646..344717)
Cluster/Prediction ref. JGI gene:   53410
Protein sequence: MlpGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167 (303)
PWM (Da):   %s   18932.62 (32807.5)  
PI (pH):   %s   8.03 (9.17) Peptide Signal:   %s   cut: 28 range:28-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSSPLYNLSAPMPNGSEFKFSDTKNKVLLIVNVASKCGFTPQYEGLEKIWQKYKEKDFLIIAFPSNNFGQQEPGTDAEVASFCKLNYGVTFPIMKKCDVNGDTASEVYKFLKEEKSGLL
GLTRIKWNFEKFLVDRNGHVRYRHASTTKPEALEKEIEELLNESAKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_42, 6 introns) and 1 EST.
DNA
Send to BLAST
CDS
Send to BLAST