Entry information : JargGPx01
Entry ID 10017
Creation 2011-12-20 (Passaia Gisèle)
Last sequence changes 2011-12-20 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: JargGPx01
Name JargGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Jaapiaceae Jaapia
Organism Jaapia argillacea    [TaxId: 202697 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value JargGPx01
start..stop
S start..stop
PstrGPx01 285 3.44e-98 5..230 40..254
GtraGPx01 282 2.35e-97 29..231 14..221
TcamGPx 277 2.46e-96 73..230 2..159
DqueGPx01 277 2.57e-96 73..231 2..160
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10017' 'join(1307097..1307416,1307473..1307495,1307551..1307618,1307670..1307843,1307902..1308009)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1307097..1307416 318 N° 2 1307473..1307495 21 N° 3 1307551..1307618 66 N° 4 1307670..1307843 172
N° 5 1307902..1308009 106  
join(1307097..1307416,1307473..1307495,1307551..1307618,1307670..1307843,1307902 ..1308009)


exon

Literature and cross-references JargGPx01
DNA ref. JGI genome:   scaffold_8 (1307097..1308009)
Protein sequence: JargGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   230
PWM (Da):   %s   25938.38  
PI (pH):   %s   9.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MISVTSHSLRTVRIAVKEPLPVFRWPYYRTTNTINTGVLSLASRHIPSPRHHHQPRHHHRSQRLLSTEATMSSAFYNLKADLPGGKIYDFQELKGKVVLIANTASQCGFTPQYKGLQALH
EKYKDQGLVVLGFPCNQFGGQEPGTDADISQFCELNHGVTFTLMKKSDVNGDNTNEVFKWLKNEKSGLLGMTRIKWNFEKFLVDKEGKVVGRWASTTSPSALDDEIKKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_8, 4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCAGTGTCACTTCGCATTCGCTGCGCACTGTCAGAATCGCAGTCAAAGAACCTCTCCCGGTCTTTCGATGGCCATATTACCGGACTACCAATACTATAAATACCGGCGTGCTTTCT
CTTGCTTCACGCCACATTCCCTCTCCTAGACACCATCACCAACCCCGACATCACCACCGTTCGCAGCGTCTTTTATCGACCGAAGCAACAATGTCGAGTGCTTTCTACAACCTGAAGGCT
GATTTACCTGGAGGAAAGATTTACGACTTCCAGGAATTGAAGGGGAAGGTTGTTTTGATCGCGAACACCGCTTCTCAATG
TGGTACGCACCCCCGCTAGATATGTGAAGACCATTCATCG
ATCCCTTTGCTTGATTAGCGGCTTCACGCCTCAATACAAAGAGGCGTGTAACATCATCCAGATGGGGCGACGTACTGATGCTGAACGTGTGTGGTTAGGCTTACAAGCCCTACATGAGAA
GTACAAGGACCAGGGACTAGTCGTCCTCGGCTTCCCTTGTAACCAA
AAGTTCGTAGCACCCTCTCTCTACCACTTCATGCATCTGATCTACTTTGTCAGTTTGGTGGCCAAGAACCAGGT
ACCGACGCAGACATCAGCCAGTTCTGTGAACTCAACCACGGAGTCACTTTCACTCTCATGAAGAAATCCGACGTGAATGGAGACAATACCAATGAGGTATTCAAGTGGTTGAAGAATGAA
AAGTCGGGTCTCTTGGGGATGACGAGGATCAAG
AGGTCAGTTTTCATCGTCTACCTTCCCAGGATCGTCGTGGTTGACGTGCGTTCGCTTTAGTGGAATTTTGAAAAATTCCTGGTTGAC
AAGGAGGGCAAGGTGGTTGGTCGGTGGGCTTCTACTACCTCACCTTCGGCCCTAGATGATGAGATCAAGAAGTTGTTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCAGTGTCACTTCGCATTCGCTGCGCACTGTCAGAATCGCAGTCAAAGAACCTCTCCCGGTCTTTCGATGGCCATATTACCGGACTACCAATACTATAAATACCGGCGTGCTTTCT
CTTGCTTCACGCCACATTCCCTCTCCTAGACACCATCACCAACCCCGACATCACCACCGTTCGCAGCGTCTTTTATCGACCGAAGCAACAATGTCGAGTGCTTTCTACAACCTGAAGGCT
GATTTACCTGGAGGAAAGATTTACGACTTCCAGGAATTGAAGGGGAAGGTTGTTTTGATCGCGAACACCGCTTCTCAATG
CGGCTTCACGCCTCAATACAAAGGCTTACAAGCCCTACAT
GAGAAGTACAAGGACCAGGGACTAGTCGTCCTCGGCTTCCCTTGTAACCAA
TTTGGTGGCCAAGAACCAGGTACCGACGCAGACATCAGCCAGTTCTGTGAACTCAACCACGGAGTCACT
TTCACTCTCATGAAGAAATCCGACGTGAATGGAGACAATACCAATGAGGTATTCAAGTGGTTGAAGAATGAAAAGTCGGGTCTCTTGGGGATGACGAGGATCAAG
TGGAATTTTGAAAAA
TTCCTGGTTGACAAGGAGGGCAAGGTGGTTGGTCGGTGGGCTTCTACTACCTCACCTTCGGCCCTAGATGATGAGATCAAGAAGTTGTTATGA

Retrieve as FASTA