Entry information : ZmPrx107(Zm00001d008173 / GRMZM2G122853)
Entry ID 1003
Creation 2005-12-13 (Christophe Dunand)
Last sequence changes 2005-12-13 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-03 (Christophe Dunand)
Peroxidase information: ZmPrx107(Zm00001d008173 / GRMZM2G122853)
Name ZmPrx107(Zm00001d008173 / GRMZM2G122853)
Class Class III peroxidase    [Orthogroup: Prx094]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx107
start..stop
S start..stop
ZmPrx44 684 0 1..348 1..348
SbPrx58 675 0 1..348 1..348
SbPrx59 652 0 1..348 1..349
SiPrx09 629 0 1..348 1..347
Gene structure Fichier Exons


exon

Literature and cross-references ZmPrx107(Zm00001d008173 / GRMZM2G122853)
Literature Bohnert,H. et al., NSF Grant DBI-0211842: Functional Genomics of Root Growth and Root Signaling Under Drought. unpublished
Protein ref. UniProtKB:   B6T7D0 [3' end]
DNA ref. GenBank:   AC187051.4 (119894..121030)
Cluster/Prediction ref. UniGene:   Zm.94452
Protein sequence: ZmPrx107(Zm00001d008173 / GRMZM2G122853)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (320)
PWM (Da):   %s   38147.48 (35384.9) Transmb domain:   %s   i7-25o
PI (pH):   %s   6.78 (6.64) Peptide Signal:   %s   cut: 29 range:29-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLSVAVLCALLAVQAAVLLATVPTSQASELEVGYYSKKCKGVEN
VVKWHVIKALKASRRTGAALVRLLFHDCFVR
GCDGSVLLDASYDNPHPEKEAPVNIGLAAFDLLEEIKAAVEKRCPGVVSCSDILIYAARDAASVLSNGHVHFAVPAGRLDGFVSKAEEAQAELPDSNQDVQQLIDNFARKNFTVEELVIL
TGAHSIGQGHCSSFTGRLSEPSQQITPAYRDLLNYKCSQGSNPPVDNNVRDEDYDVVARFMPGFTSRVRKIPDFLDNSFYHNNLAKIVTFHSDWTLLTHKEAFGHVVEYAENATLWDEDF
SDSLLKLSKLPMPKGSKGEIRKKCSVVNHRLY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, intron 1) and 62 ESTs. The TCs contain ESTs from ZmPrx44. Cultivar="W23", "B73" and "Hybrid 35A19". Also found in AC183972.3.
DNA
Send to BLAST
CDS
Send to BLAST