Entry information : WcoGPx01
Entry ID 10030
Creation 2011-12-21 (Passaia Gisèle)
Last sequence changes 2011-12-21 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: WcoGPx01
Name WcoGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Wolfiporia
Organism Wolfiporia cocos    [TaxId: 81056 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value WcoGPx01
start..stop
S start..stop
TcamGPx 291 3.55e-103 1..159 1..159
LsulGPx01 289 2.95e-102 1..160 1..160
DqueGPx01 288 5.58e-102 1..160 1..160
SbreGPx01 286 4.73e-101 2..159 7..164
Gene structure Fichier Exons


exon

Literature and cross-references WcoGPx01
DNA ref. JGI genome:   scaffold_5 (1651580..1652309)
Protein sequence: WcoGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   159 (312)
PWM (Da):   %s   17919.11 (34738.1)  
PI (pH):   %s   8.45 (9.23) Peptide Signal:   %s   cut: 24 range:24-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSFYELKAELPGSKTYDFEQLKGKVVLVVNVASKCGFTPQYKGLQALYDKYKDRDFLILGFPCNQFGGQEPGDDEAIGQFCQLNHGVTFPLMKKSDVNGDNTNAVFKWLKNEKAGLLGM
TRIKWNFEKFLVDRNGKVVNRWASTTTPEAIDAEVAKFL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_5, 4 introns). Strain "MD-104 SS10".
DNA
Send to BLAST
CDS
Send to BLAST