Entry information : RcPrx[P]89
Entry ID 10040
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-01-03 (Qiang Li)
Peroxidase information: RcPrx[P]89
Name RcPrx[P]89
Class Class III peroxidase     [Orthogroup: Prx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcPrx[P]89
start..stop
S start..stop
RcPrx17 298 2e-102 1..223 54..331
PtPrx30 285 6e-97 1..223 56..333
PbPrx02 284 1e-96 1..223 56..333
PtPrx45 284 1e-96 1..223 56..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 102199..102264 66 N° 2 101741..101838 98 N° 3 101417..101507 91 N° 4 100851..101259 409
complement(join(100851..101259,101417..101507,101741..101838,102199..102264))


exon

Literature and cross-references RcPrx[P]89
DNA ref. Phytozome 12:   29634 (102264..100851)
Protein sequence: RcPrx[P]89
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221
PWM (Da):   %s   23980.24  
PI (pH):   %s   8.8
Sequence 264
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
VVKEAIMAALLFKLRFHDCFVEGCDTSxLLDSNGSIISEKGPNTHRSSAPGFEVINNIPAPNNIFQATLTKYKHQGLSVVDLVALSGSHTIGNARRTSFRQRLYNQPGNGQxDYTLD*SYAAQLGVHxPISGGDQNLFLLDFASPAKFDNSYFRNLLAPESQLSSD*VLLTxNKAPIELVKKYAENNELFFEHFAKSMNKRGNIPRLTGLREEFRKNCGKIDA

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' end is missing; Gaps in frame; Stops in frame). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAAGAAGCTATAATGGCTGCCTTATTATTTAAGCTTCGTTTTCATGACTGCTTTGTCGAGATTTGTTAAGTCTCTGGAAATAAACCTACCAATATCCATGTAATTGAATACTCATGATA
AAATGTTCATAAGCATGTATTTATCATTACTATATTAATCTGTTAGGCATTAAGGTACAACCTTTTTTTTTTGGAACAAAACCCTTGTTTAGGTGTAAGAAATTCAAGGAAAAATAAACA
AATAACAGTTTCGAAGGATTTGTTTATTTGTTTTGTAATTAGAATGACTGGAACATGTCAATTTCATCTTATTTTTAATTGTCCTTGATTCTAGATACTGTTTTCTCAACCATAGCTAAA
TTACGAGTACAAGGGATCACTTGACATACAACTACAAGCACACAAAGCTCTTCTATTACAGGGTTGTGATACATCTCANCTGTTAGACAGCAATGGAAGCATAATCAGTGAGAAGGGCCC
TAATACACACCGAAGCTCAGCTCCAGGATTCGAAGTAATAGAGA
AAGAGTGTCCTCATACCGTATCTCGTGCTGATGTTTTTGCCTTAGTTGATAATTAGACTCCAGGGTTCTGGTAAGT
TCTACTGCTTAGCACTATAGTGAAATTAAACTAACCATAGCTTGCCAAAATCCTGGGGGAACCATTCTCTTTTGATATACACAGGCTGGAGAACCAAGCTGAGAACTTCGATTGGGAAGA
AGGGACTTAACAGGTGCTAGCTTGTGTGGTTCTAACAACATTCCTGCTCCAAATAACATATTTCAAGCAACTCTTACTAAGTACAAGCACCAAGGCCTCAGTGTTGTTGATCTTGTAGCA
CTATTTCG
TAACTGAATTTGGCTTTCTGCGTTCTTAGTGTTTCTCTTCTTTCTGATAAGAGTTCATTGAGTGTCAGGAATAATAAATTATCAGTTATGCAAATTCCCTCTTCAACAAAGG
ACATGATGAATGTACATAAACTACGGCCCATGAGTTTCTTGCAGGAAGCCACACAATAGGAAATGCTCGACGCACCAGCTTCAGGCAGAGACTGTACAACCAGCCAGGAAATGGGCAACT
NGATTACACACTTGACTAATCATATGCTGCACAGTTGGGCGTGCACTCNCCTATATCAGGAGGTGATCAAAATTTGTTTCTCTTGGACTTTGCAAGTCCAGCAAAGTTTGATAACAGCTA
TTTCAGGAATCTACTTGCTCCAGAGAGCCAGTTGAGTTCTGACTAAGTTCTCCTGACAGNNAACAAAGCACCCATTGAATTGGTCAAGAAATATGCTGAGAACAATGAGCTCTTCTTTGA
GCACTTTGCTAAGTCAATGAATAAGAGGGGAAATATCCCTCGATTGACAGGTTTAAGGGAAGAGTTCAGAAAGAATTGCGGGAAAATTGATGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAAGAAGCTATAATGGCTGCCTTATTATTTAAGCTTCGTTTTCATGACTGCTTTGTCGAGATTTGTGATACATCTCANCTGTTAGACAGCAATGGAAGCATAATCAGTGAGAAGGGCCC
TAATACACACCGAAGCTCAGCTCCAGGATTCGAAGTAATAGAGA
ACATTCCTGCTCCAAATAACATATTTCAAGCAACTCTTACTAAGTACAAGCACCAAGGCCTCAGTGTTGTTGATCT
TGTAGCACTATTTCG
AAGCCACACAATAGGAAATGCTCGACGCACCAGCTTCAGGCAGAGACTGTACAACCAGCCAGGAAATGGGCAACTNGATTACACACTTGACTAATCATATGCTGC
ACAGTTGGGCGTGCACTCNCCTATATCAGGAGGTGATCAAAATTTGTTTCTCTTGGACTTTGCAAGTCCAGCAAAGTTTGATAACAGCTATTTCAGGAATCTACTTGCTCCAGAGAGCCA
GTTGAGTTCTGACTAAGTTCTCCTGACAGNNAACAAAGCACCCATTGAATTGGTCAAGAAATATGCTGAGAACAATGAGCTCTTCTTTGAGCACTTTGCTAAGTCAATGAATAAGAGGGG
AAATATCCCTCGATTGACAGGTTTAAGGGAAGAGTTCAGAAAGAATTGCGGGAAAATTGATGC

Retrieve as FASTA