1. Browse the Database
  2. View Redoxidase
Entry information : CclPrx124
Entry ID 10044
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2012-01-04 (Qiang LI)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-01-03 (Qiang Li)
Peroxidase information: CclPrx124
Name CclPrx124
Class Class III peroxidase     [Orthogroup: Prx040]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx124
start..stop		 S start..stop
CclPrx68 479 5.31e-173 1..242 109..349
CsPrx54 470 1.81e-169 1..242 109..349
CclPrx05 467 3.05e-168 1..242 109..350
CsPrx52 466 3.57e-168 1..242 109..350
Gene structure Fichier Exons►


exon

Literature and cross-references CclPrx124
DNA ref. Phytozome 12:   scaffold_31 (1142675..1132928)
Protein sequence: CclPrx124
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   242
PWM (Da):   %s   26092.11  
PI (pH):   %s   8.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAAVERACPGVVSCADILTIAAEESVALSGGPAWTNLLGRRDSRTANRTLANENLPGPNNSLERLKDRFRNVGLNDNFDLVALSGAHTFGRAQCRTFSDRLFNFNNTGNPDPTLNTTLL
QQLRQLCPQGGNGSVLTNLDVTTPDLFDNKYFFNLQISKGLLQSDQELFSTPGADTTAIVNVFSSNQAAFFKSFVISMIRMGNLKPLTGNQGEIRLNCRRVNGNSNIATRSSSSEGDLVS
SF

Retrieve as FASTA  
Remarks Partial sequence from genomic (5' end is missing). No prediction from phytozome.
DNA ►
Send to BLAST
CDS►
Send to BLAST