Entry information : CclPrx124
Entry ID 10044
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2012-01-04 (Qiang LI)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-01-03 (Qiang Li)
Peroxidase information: CclPrx124
Name CclPrx124
Class Class III peroxidase     [Orthogroup: Prx040]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx124
start..stop
S start..stop
CclPrx68 479 5e-173 1..242 109..349
CsPrx54 470 2e-169 1..242 109..349
CclPrx05 467 3e-168 1..242 109..350
CsPrx52 466 3e-168 1..242 109..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1142589..1142675 87 N° 2 1141828..1141996 169 N° 3 1140931..1141299 369 N° 4 1132928..1133031 104
complement(join(1132928..1133031,1140931..1141299,1141828..1141996,1142589..1142 675))


exon

Literature and cross-references CclPrx124
DNA ref. Phytozome 12:   scaffold_31 (1142675..1132928)
Protein sequence: CclPrx124
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   242
PWM (Da):   %s   26092.11  
PI (pH):   %s   8.21
Sequence 283
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAAVERACPGVVSCADILTIAAEESVALSGGPAWTNLLGRRDSRTANRTLANENLPGPNNSLERLKDRFRNVGLNDNFDLVALSGAHTFGRAQCRTFSDRLFNFNNTGNPDPTLNTTLLQQLRQLCPQGGNGSVLTNLDVTTPDLFDNKYFFNLQISKGLLQSDQELFSTPGADTTAIVNVFSSNQAAFFKSFVISMIRMGNLKPLTGNQGEIRLNCRRVNGNSNIATRSSSSEGDLVSSF

Retrieve as FASTA  
Remarks Partial sequence from genomic (5' end is missing). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGCTGCCGTTGAAAGGGCCTGTCCAGGCGTTGTTTCCTGTGCTGATATTCTTACTATTGCAGCTGAAGAATCTGTTGCTCTGGTATGTGTGAATTTCTATTAACAACTCCTCATC
TTTCTCGACTACATATTTTATGCTTAAAAGTGATTAAATTACTATGGTATCAGAGTGTAAGTTTGACTTTACATTCGTGTTGGAATTTTCAGACCCTGAGTACTTTAACTAAATGAATCC
ACATGCTTAGTTTTGAGCGGCAACAGTCCCATCGAATTACCATGTTGACTTCGTGATAGCCCCGGGCCAAATTTTCCGTTTGAAAAGGGGAGGGTTTTTCTTTNNNNNNNNNNNNNNNNN
NNNNNNNNNAAAAAAAAAACACAAAAAAAAACGGTGATGCGATTCATCGAGGACACATCAGTTTTACGTGCTGGGTTCCAGTATATATTTTGAAAAAAAAAAAAAATTCTTCTTTATATG
ATACAGTCTGGTTGAACCGTTCACTCAAAATTATAACGTCGGGAAACTGCTAATTTTGGGTGCAACAAGACCCATATAAATATTAGCCAAATAGAGTCGGAAAGATTAATTGCATGTGTC
TTTCTAATTTTAGTTAAATTTGTTTATTATGCATCTCTCAAGTGATGCTTTTGACTAATGATCGTGGTTTTGGTAACAGTCAGGGGGTCCTGCATGGACAAATCTATTGGGAAGAAGAGA
CAGCAGAACAGCAAACAGGACTCTTGCAAATGAAAATCTTCCAGGACCGAACAATAGTCTTGAGAGGCTCAAAGATAGATTCAGAAATGTTGGCCTCAACGACAATTTTGATCTTGTTGC
ACTCTCCG
GTAATATTTGCTTTTACGCCCTTTGACTTGAGTACAAACAGACCTTGGAGTCTTTTGGGATAAAGCAGTATTGGAGCCAGAATTAGAAATCTGGATGGTGGAAAATTTTTTA
ATGCCAATACTGAGTCTTGAAATCTTAGAGATAGTTTAAATGTTGAATATCTTATTTAAAAAGAAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNTTACTAAGACGACCACCGACACAAAGCACATTCATACTCTACAGCACCTAGGAGGCTTGACTGAATATCCTAATGATGCGAAGAAACTGTGTTTTAAAGTTTGACATT
GGTGATTAGGAATATGTTAAAACGTTTGACAAATTTACTCCCCTTAATCACATCATGAAATTTGAATTGCTTCCCAAAAAGAAAAGTGAGAACCACCATAATGAAACTCAGTTATTATCC
TTAATTTGTATGAATTTGAGTAAAAATAACAAAGATCGGCTATGCATGTTTTTCAGGAGCTCACACGTTTGGAAGGGCTCAGTGCCGAACTTTTAGCGATAGATTATTCAATTTCAACAA
CACTGGCAATCCAGACCCAACACTTAACACAACCCTCTTACAGCAACTTAGGCAACTATGCCCACAAGGTGGAAACGGCAGCGTTCTAACTAATCTTGATGTCACAACACCTGATTTGTT
TGACAACAAATACTTCTTCAATCTTCAAATCAGCAAGGGCCTTCTGCAGAGTGATCAAGAGTTGTTTTCGACTCCCGGTGCCGATACCACTGCCATTGTCAATGTCTTTAGTAGCAACCA
GGCTGCTTTCTTTAAAAGCTTTGTGATTTCAATGATAAGAATGGGGAATTTGAAACCATTGACAG
GCAATCAAGGGGAGATTAGATCGAACTGCAGGAGGGTCAACGGAAACAGTAATAT
AGAAACCAGATCATCGTCAGAGGGTGATTTGATCAGCTCTTTCTAAATAAGCTAGTTTGCAGCACATGTGAGAGATAGAGTTTGTGGGTAACAAACTCGTGAATTTACTCCTATGTTTTG
CCTGAAACATGCTTTTTATTTTCAATAAACTAAGGTTGTGTTTGTGTATTCACATCCTTGCTTTCTATGTATCAGAAATCCTTGTCATACAGTATGTGTGTATTTTTTTTCCTATGTCAT
CGGTACGCATTGTCATCTGAGTCACTTTCCAGTTTTTAGTGATCCATTTTATCCCCCAGCTTTAAAATATTAACCGGAAAAAAACCTTATTCTTACATATTTCTTTCTATTTCTACTTTT
TGTCAAATATCCGTAGTTTGACAAAATAGTAGGGAAGAATCTTTTATTTTCAGAAATAATCATACATAGCTTTTTTTATGGGATAACAAAACTTATTTTTAGACAAATTTTAAAAATCCA
TTTGACAATTTTTGGGGTCTGTGTGTACCAAAAAAGAGCCTATATAATTTCTAAAACCAATTGAATCTCCGTACTATTTCACTAAACCATTTCGCAAGGCAAACACTAACTTACAACTGC
TGTAAGTTACAGCACTCACAAAAATATGCATGAACAGTAATAAATGGTGGGTCCCATGTAATTTTTGTGTGTGCTGTAACTTACAGCTGGCTGTAAGTTAGGGGCTCCCATTTCGCAATT
ATTATGATCCTTTTTCCCCATAAAAGAAAACATTAGTAGCAACAGTTATCTTTTTCATGATCATTAATAAAATCATTTTTTACCCATTTCAAAAGTCATCCAGCCATTTCTTAATTATTT
AACTCCCACTTGAGGTTTCAATTAATCAAGACCTCATTTGAAATTAAAGTAAGACCGATTTACCTTTTAAAAACAACATTAAATTATTTAGAAAATATTTACTGCTATTTTTAAAACCTC
ATTTGAAATTAAACTTCGAGGTTGCTGCAAAGTTCTAATCCTAATCTGGTTTGTTTGGTTATAAATAAAGAGGCATTTCTCTTTGTTTTCCAAGTCCTAAGACTAATTATTCTCTTAATA
GAGAAGTAGTAACTCTTAGACAAAATGGCTTCACTTCGTTATCTTCTTGCAGCAGCTCTTGTTGTTGCTTTTGTGCTTGAGGGATCACCATCTCAAGCTCAACTTTCTCCCTCTTTTTAT
TCTTCCACATGCCCTAATTTATTGAACATTATCGAGGATGTGCTTAAGAAAGCTTTCTCGTCCGATATCCGCATCGGTGCCAGCCTCATCAGGCTTCATTTCCATGACTGTTTTGTTGAT
GTAAGCAATCTCTGCTCTCTCATTTTTCATCTTCTTTACGTTATCAAGCTCTCTGTCTATTTACTTATTGATATAACATAGTTTCAAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCGGGTTTGCGGGTACAATTGCCAT
CCCTAGTTTCAAGCATGTCAATGAACAGTATCTTTATAATTTTTTGTGTCATTAAACAAAATATAGAGTTTTCATTAAGAGTTTGAATATATCATTTTAATTTCAACAACTTCCAAAACC
ATTTTCATATATCTTTTTTTTTTCTCTTTTTCTTTTCTCTTTACGACAAATTTTTCCTCTCTAATTCGATGTACCGAGGACCATGTAATTCTTTGNNNNNNNNNNNNNNNNNNNNNGGGG
TTTTCATGTACTAGAAATTTAAATCTAGCAAAGATTTGGTCCAAAACAGGAATTCAAATCCACCTCATGGCCTCATCCCTGCTCAGTGCTTTTAATGATCATGGGTCCAATATTAATGGT
GCATGGTTGAAAAAAAATCACACTTGTTTTATATTCTTCCAACCGAAAATTTTGAATCAACAGGAAATCCTAGTCTTAAAAACATATGTAATAATAAGACAATTTAAATAAGAAGAGTTT
GCATTATTTATTTAATTTTTTTGAATTCATGTCCATAAGATAAGAAGGAATCTATCTACTTGTTAAAATAACAATATAATGGACTGTTAACATAGCAAGTTGTTAACTAATACTATTTTT
TCCGGGGTGTGATGCATCGATTTTGCTGGACAGCACTAAAAACATAGACAGCGAGAAATTTGCTGCGCCAAATAATAATTCGGCGAGGGGTTTCGAAGTTATTGATAACATGAAAGCTGC
CGTTGAAAAGGCATGTCCAAGGGTTGTTTCCTGCGCTGATATTCTTACTATTGCGGCTGAACGATCCGTTGCTTTGGTATGAATTTCTTTTACCAACTCCTCTTCCTTATTAATATTTTA
TGCTTAGAAGTAAATTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTTGTAATGTAATTATTTTTTAATCTCAACCAATANNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTTGTAATGTAATTA
TTTTTTTAATTTCAACTAGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGGAAATAAAACCGCACT
TCGCGCAGTTTTGAAAAAAAATTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNGATGGGTATCAAAATAAGTGAACAGAATAATGGTAAATCTTTGCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCGTAAGTTCAACTTTACCCTTAGAAGAATACATTAATTAAATAATTATTCACATAGACCAATGTGCAAGATCTGA
GTCCACATGTTTAGCCTTTGATTTAAGTGAAGGGATTCATAGTTGGACCCATCATTATTAAATTGGGACGACGCAATGGACTCCATTATTTAAAAGGCCCGGCTACAGTGCAACTGTGAT
ACCGTGCTACAGTTACATTCAGCCGTTGGATCCACTTAGATGAGTGGAGTCTATTAGAATTTAATGGCTGGATGCAACAGTAGCACGGTACCATATTTGCACCACAATTTTTCCCTTATT
TAAAAGGGGTGACTTATTGACTATGGTGCATCAGCTACACTGTGTGGTACCAAAATTGCTACACATATGTCAATATAGTGATTATTAAGGGATAAATTGTTACTGACAGTGAGACACTTT
TTACTGCGCTGGTGCATCGTAGCAAGTCCTTAGTTTTAAACTTAAAAGTTTTCTTCTTTTGTTATACGACAAAGTTTTGATTCAACGGCTAGCAAATTAAATAGTCCGCCCCAAACGCAC
ATCTCTTAAGATTATTGTTGATTTTGAGTGAATGGCTTTTGGTTACAGTCAGGGGGTCCGTCATGGGCAGTTCCATTGGGAAGAAGGGACAGCAGAACAGCAAACAGAGCTCTTGCAAAT
CAGAAACTTCCAGGACCATCTGATACTCTTGATGTGCTCAAATCTAGTTTTAGAAATGTTGGCCGCAATGACAATTTTGATCTTGTTGCACTCTCCGGTAATTATTAATTGCTTCTGCAT
CCTTTTAATTACTTGAGTAAAGTTATGGGAGTAGACTTTTAAAAGTCAAAAGAGCATGGTACTAGCAAACCACGCTCAAAAATTAATTTAAGAAATGAGTGTTATGCCTTAAATTTATGT
ATACTTAACTCAAAATTGGGCATGCATGTTTTTCAGGAGCTCACAGGTTTGGTAGGGCTCAGTGCCGATTTTTCAGGGGCAGATTATACGATTTCAACAACACTGGCAAGCCAGACCCGA
CACTGGACAGAACCCTGTTAAAGCAACTGAGGGAACTATGCCCACAAGGTGGAAACGGCGGCGTTCTTGCTAATTTTGATGTCAAAACACCTGATGTTTTCGACAACAAATACTTCTCCA
ATCTTAGACTCCGCAAAGGCCTTCTGCAGAGTGATCAAGAGTTGTTTTCGACTCCTGGTGCCGATACCGCTGCCATTGTCGAGGACTTTGGGAGGAACCAGAATGCTTTCTTTAAAAACT
TTGTGACCTCAATGATAAGAATGGGCAATTTGAAACCACTGCAGGAAATCAAGGGGAGATTAGATTGAACTGCAGGAGGGTCAATGGAAACAGTAATATTGCAACAAGATCATCATCATC
GGAGGGTGATTTGGTCAGCTCTTTCTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGCTGCCGTTGAAAGGGCCTGTCCAGGCGTTGTTTCCTGTGCTGATATTCTTACTATTGCAGCTGAAGAATCTGTTGCTCTGTCAGGGGGTCCTGCATGGACAAATCTATTGGGA
AGAAGAGACAGCAGAACAGCAAACAGGACTCTTGCAAATGAAAATCTTCCAGGACCGAACAATAGTCTTGAGAGGCTCAAAGATAGATTCAGAAATGTTGGCCTCAACGACAATTTTGAT
CTTGTTGCACTCTCCG
GAGCTCACACGTTTGGAAGGGCTCAGTGCCGAACTTTTAGCGATAGATTATTCAATTTCAACAACACTGGCAATCCAGACCCAACACTTAACACAACCCTCTTA
CAGCAACTTAGGCAACTATGCCCACAAGGTGGAAACGGCAGCGTTCTAACTAATCTTGATGTCACAACACCTGATTTGTTTGACAACAAATACTTCTTCAATCTTCAAATCAGCAAGGGC
CTTCTGCAGAGTGATCAAGAGTTGTTTTCGACTCCCGGTGCCGATACCACTGCCATTGTCAATGTCTTTAGTAGCAACCAGGCTGCTTTCTTTAAAAGCTTTGTGATTTCAATGATAAGA
ATGGGGAATTTGAAACCATTGACAG
GAAATCAAGGGGAGATTAGATTGAACTGCAGGAGGGTCAATGGAAACAGTAATATTGCAACAAGATCATCATCATCGGAGGGTGATTTGGTCAGC
TCTTTCTA

Retrieve as FASTA