Entry information : MguPrx[P]111
Entry ID 10048
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-01-03 (Qiang Li)
Peroxidase information: MguPrx[P]111
Name MguPrx[P]111
Class Class III peroxidase     [Orthogroup: Prx017]*
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguPrx[P]111
start..stop
S start..stop
MguPrx90 272 4.96e-93 1..163 1..185
OcPrx24 139 3.76e-41 2..162 5..176
NtPrx23-1B 124 4.61e-35 39..162 50..190
NtPrx81-1B 123 4.74e-35 39..162 39..179
Gene structure Fichier Exons


exon

Literature and cross-references MguPrx[P]111
DNA ref. Phytozome 12:   scaffold_98 (10770..11690)
Protein sequence: MguPrx[P]111
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163 (299)
PWM (Da):   %s   17718.23 (32011.2)  
PI (pH):   %s   7.43 (8.50) Peptide Signal:   %s   cut: 26 range:26-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ILLIFLSSVLFFCFSATRGTIHIHHTRFVPERRGHCQPSxVNRAAIDNSRVSLILLQLYFHDSFVEGCDGSILLxQRADSECKTSTRICLPDVVSCVDIVVMAARDAIVLTGGPIYAVET
GRRDVTVSSRLLATDMPDSRDSVDILKSKFFSKKLSEAELVID

Retrieve as FASTA  
Remarks Pseudogene from genomic (Both 5' end and 3' end are missing; Gaps in frame). No prediction from phytozome.
DNA
Send to BLAST
CDS
Send to BLAST