Entry information : MtPrx111 (Medtr2g029560.1 [4.0])
Entry ID 10051
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2014-07-16 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-25 (Catherine Mathe)
Peroxidase information: MtPrx111 (Medtr2g029560.1 [4.0])
Name (synonym) MtPrx111 (Medtr2g029560.1 [4.0])
Class Class III peroxidase    [Orthogroup: Prx237]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx111
start..stop
S start..stop
MtPrx30 592 0 1..344 1..345
GmPrx01 533 0 1..338 1..342
PvPrx01 490 7e-176 22..338 22..338
GmPrx69 475 1.04e-169 22..338 22..338
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10051' 'join(11095150..11095356,11095644..11095835,11097371..11097536,11097661..11098130)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11095150..11095356 205 N° 2 11095644..11095835 190 N° 3 11097371..11097536 164 N° 4 11097661..11098130 468
join(11095150..11095356,11095644..11095835,11097371..11097536,11097661..11098130 )


exon

Literature and cross-references MtPrx111 (Medtr2g029560.1 [4.0])
DNA ref. Phytozome 12:   chr2 (11095150..11098130)
Cluster/Prediction ref. Phytozome Gene 12:   31067650
Other ref. Medicago_jcvi:   23232
Protein sequence: MtPrx111 (Medtr2g029560.1 [4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344 (322)
PWM (Da):   %s   37157.55 (34838.4)  
PI (pH):   %s   4.86 (4.73) Peptide Signal:   %s   cut: 23 range:23-344
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSINVLGVVFWCAVLMHAGYAQLSPSFYSQTCPFLYPIVFRVIF
EASLTDPRIGASLIRLHFHDCFVQ
GCDGSVLLNNTNTIVSEQDALPNINSLRGLDVVNQIKTAVENECPATVSCADILTIAAQVASVLGGGPSWQIPLGRRDSLTANQALANQNLPAPFFTLDQLKAAFLVQGLNTTDLVTLSG
AHTFGRAKCSTFINRLYNFNSTGNPDQTLNTTYLQTLREICPQNGTGNNLTNLDLTTPNQFDNKFYSNLQSHKGLLQSDQELFSTPNADTIAIVNSFSSNQALFFENFRVSMIKMANISV
LTGNEGEIRLQCNFINADSSGLSGGASKDELLSSF

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCATAAATGTACTAGGGGTGGTATTTTGGTGTGCAGTCTTGATGCATGCTGGGTATGCTCAGCTTAGTCCCTCATTTTACAGCCAAACATGTCCATTTCTATACCCTATTGTG
TTTAGAGTCATATTTGAGGCTTCTCTCACTGATCCACGTATTGGTGCCAGTCTCATTAGGCTTCATTTCCATGATTGCTTTGTTCAA
AAGTATGTTATTAATTAATTGTTAATTACTTTT
TGTTAATCCTTATAAAGCTCTTCCTATATATAGATCATGATTTTTTAAATTTCTTATACTAGACCTAACACAAAACCCACTTTTATTTGAATGAACACTATATATAATGAACACTTTTAT
TTGTGTTACTAAAAAAACATGTTTGTAACAAAGATCTTTTTTTAAAGTAGTGTTTGCATAGATTTTTGTCTTTTAGTGGTGAAGACACAAATGAAAGTCTTATAACAAAGTTGTTATCTA
TGCATGTTTGTGACAGGGTTGTGATGGATCAGTTTTGTTGAACAACACTAATACCATAGTAAGTGAGCAAGATGCACTTCCAAACATAAACTCATTAAGGGGTTTGGATGTTGTAAACCA
AATCAAGACAGCAGTTGAAAATGAATGTCCAGCCACTGTTTCTTGTGCTGATATTCTTACTATTGCAGCTCAAGTAGCTTCTGTTCTG
TGGTATGTTTTATCATTAATTTCATCAATTTT
TTTTTATTACCTAGCTTTTTTTTTGTGGTGTCCGGAGCTCAATCTCACATATATTATGCGTTGTCCTAACCAACTGACCTAAGCTCTACCTAGCTAATTATATAGATAAATTATTACAAA
AATTTAATGTTTTTTTTTTTTTAATATCTGGAAAATTTCCATTCTCTACGAACATTAATTAATGTATATAGTTAATTATCAATCGTACATGATACTTGAAACTACTATTGGCAATATGAA
ATAGTTTTATTGTTTTCTTTTGCAGGGTGAATTTTTAATTTTATAGTGATAACTTTGGGTAACGAGGAATAGTTTGACTAATTAATCTATTTTGCTCACTAAAATAATTGACAGGACCTC
AACTTGATCCTACATATACTAAAAATAATTAATGTCATAGTTAAAATTGAACCTCACTGGCTTTGATCAGATCAACAAATGAGCAAAAGTTGACCTGAAAACAAAACATAAAAAAAAGAA
GTACATTTGATCATCAACTAATATAAATAATTTATTTGGACTCTAATAATCACGCCTAGCTAATGTTGAACCTTTTGTTTGACTAAAGCTAATGTTGAACTTGTTAAGGGAGCATCTACG
ATTCATGGTAAATAAAAGCGTTTAATATGATAAAATTAAGTCTTGAGAGACTCTTCTATACCAAATTAATATTTAGTTGAACTCTCCTCATTACCAATTTAAATCCTAACTAGTACTGTT
GGTCATTTTATTGAAAGTTGAACCACGAAAATAACTATCTATAGATTAGACTAAGGCACTCCATTGAAGACTGAAAGGCGAATGAAGTCGTCAAAGGGAAATAACTATCATTATGTCAAT
TATGAAAGAGTGAAAACCACCATAAACTTTAGCCCTTAAAAGATGAGGCAATGTTATGATGAATCAAACTTAATTTTATTAGATTAAAATTCTCAATATAATACATAAGTCATGATTCTC
TCTCACCTAAAAGATCGGTCATTTTAATTGAACTCTTCTCATAAACTTAAGTCTTTTTTTCCACAAATCGGCATAGTTCAACTAGTTGACGTTGGAACTTGGAAGGAGTTTGAGAAGAGA
GATCAAGATTCAAAACTAACCTACTAACATGACTACCTCCATCCCGTTATATATGCTCATTTTATTATTTTCACTTATATTTAAAAAAAATGTGTAATATATAATGTTTTATTTTGTGTA
CGAATGTCTTCAGCTATGATTTTTTTTTTCCATCTTCCAAGACACAAAATAATATTAATAAGAGGTATTCTTTTCTCTAATGAGGGCTTATATTCAGAGAACAATCTACTAATTATTAAA
GAAAGTTTTATCTTTGTAATAGAGAGATAACACAACTAGTATATGCCAAATATTTATGCAATTTTGAAGTGACAATCAAAACAAAAACTGCAGCTTCCATATGGCCACTTTTATTTTTCT
GTATTCTTTTTTCCTTCTCACATATCCATCTTAAACTAGTGATTAATATATTGGTTTATGAACAGGGAGGAGGTCCCTCATGGCAAATTCCATTGGGAAGAAGGGATAGTTTAACAGCAA
ACCAAGCCCTTGCAAATCAAAACCTTCCAGCACCCTTTTTCACATTGGATCAACTTAAAGCTGCATTTCTTGTTCAAGGTCTCAACACTACAGATTTAGTTACACTCTCAG
AGGTATTGC
ATATAATCAATTTAATAAAAATCGTTCAAAAACTAATTTACATTGTAATTAAAACTCTTAGAAATATTATGCAACATATATGTAACCTGGAATTCTAACAATTTTATATATGTCCAGGTG
CTCATACATTTGGAAGAGCTAAGTGTAGCACCTTCATTAATCGTTTATACAATTTCAATAGCACTGGAAATCCTGATCAAACTCTAAACACAACTTACTTACAAACATTGCGTGAGATAT
GTCCCCAAAATGGAACAGGGAACAATCTCACCAATTTGGACCTTACTACACCAAATCAATTTGACAACAAATTCTACTCCAATCTTCAAAGCCACAAAGGCTTGCTTCAAAGTGATCAAG
AGTTATTCTCAACTCCTAATGCAGATACCATTGCTATTGTTAATAGCTTTAGTAGCAACCAAGCTCTCTTCTTTGAGAATTTTAGGGTGTCCATGATTAAAATGGCTAATATTAGTGTGC
TAACCGGTAATGAAGGGGAAATTAGGTTGCAATGTAATTTTATTAATGCAGATTCCTCTGGATTATCTGGTGGTGCATCAAAAGATGAACTTTTAAGCTCATTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCATAAATGTACTAGGGGTGGTATTTTGGTGTGCAGTCTTGATGCATGCTGGGTATGCTCAGCTTAGTCCCTCATTTTACAGCCAAACATGTCCATTTCTATACCCTATTGTG
TTTAGAGTCATATTTGAGGCTTCTCTCACTGATCCACGTATTGGTGCCAGTCTCATTAGGCTTCATTTCCATGATTGCTTTGTTCAA
GGTTGTGATGGATCAGTTTTGTTGAACAACACT
AATACCATAGTAAGTGAGCAAGATGCACTTCCAAACATAAACTCATTAAGGGGTTTGGATGTTGTAAACCAAATCAAGACAGCAGTTGAAAATGAATGTCCAGCCACTGTTTCTTGTGCT
GATATTCTTACTATTGCAGCTCAAGTAGCTTCTGTTCTG
GGAGGAGGTCCCTCATGGCAAATTCCATTGGGAAGAAGGGATAGTTTAACAGCAAACCAAGCCCTTGCAAATCAAAACCTT
CCAGCACCCTTTTTCACATTGGATCAACTTAAAGCTGCATTTCTTGTTCAAGGTCTCAACACTACAGATTTAGTTACACTCTCAG
GTGCTCATACATTTGGAAGAGCTAAGTGTAGCACC
TTCATTAATCGTTTATACAATTTCAATAGCACTGGAAATCCTGATCAAACTCTAAACACAACTTACTTACAAACATTGCGTGAGATATGTCCCCAAAATGGAACAGGGAACAATCTCACC
AATTTGGACCTTACTACACCAAATCAATTTGACAACAAATTCTACTCCAATCTTCAAAGCCACAAAGGCTTGCTTCAAAGTGATCAAGAGTTATTCTCAACTCCTAATGCAGATACCATT
GCTATTGTTAATAGCTTTAGTAGCAACCAAGCTCTCTTCTTTGAGAATTTTAGGGTGTCCATGATTAAAATGGCTAATATTAGTGTGCTAACCGGTAATGAAGGGGAAATTAGGTTGCAA
TGTAATTTTATTAATGCAGATTCCTCTGGATTATCTGGTGGTGCATCAAAAGATGAACTTTTAAGCTCATTCTAA

Retrieve as FASTA