Entry information : MtPrx114 (Medtr3g105790.1 [4.0] / Medtr3g105790.1[3.5])
Entry ID 10054
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-07-16 (Christophe Dunand)
Peroxidase information: MtPrx114 (Medtr3g105790.1 [4.0] / Medtr3g105790.1[3.5])
Name (synonym) MtPrx114 (Medtr3g105790.1 [4.0] / Medtr3g105790.1[3.5])
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx114
start..stop
S start..stop
MtPrx107 666 0 1..324 1..324
GmPrx151 514 0 1..322 1..325
GmPrx295 496 1e-178 1..322 1..329
GmPrx67 488 2e-175 1..322 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10011819..10012028 210 N° 2 10010720..10010899 180 N° 3 10010462..10010627 166 N° 4 10009421..10009836 416
complement(join(10009421..10009836,10010462..10010627,10010720..10010899,1001181 9..10012028))


exon

Literature and cross-references MtPrx114 (Medtr3g105790.1 [4.0] / Medtr3g105790.1[3.5])
DNA ref. Phytozome 12:   MtChr4 (10012028..10009421)
Protein sequence: MtPrx114 (Medtr3g105790.1 [4.0] / Medtr3g105790.1[3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (301)
PWM (Da):   %s   35427.56 (32924.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.57 (4.55) Peptide Signal:   %s   cut: 24 range:24-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METTKSMFLFIAVSILFVSSVTANLAFDFYAASCPTAELFIRNAVSTSSSNDPSIPGKLLRMVFHDCFVEGCDASLMLQGNNTEQSDPGNRSVGGFSVIETAKRVLEMFCPGTVSCADIIALAARDAVEIAGGPRVQIPTGRRDGMVSIASNVRPNIVDTSFTMDEMLKLFSSKGLSLLDLVVLSGAHTIGTAHCNTFRGRFQQDRNGSLRLIDQTIDTNYADQLIKQCPINAQPSVAVNIDPETSMLFDNQYYRNLLDRKVLFQSDSVLMNNDDTRKLVEDFANDQELFFDNWGVSFVKLTSIGVKTDEEGEIRRSCAATNI

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGACAACAAAATCAATGTTTCTTTTCATAGCAGTTTCTATCTTGTTTGTTTCCTCTGTAACTGCTAATCTTGCTTTCGACTTCTATGCTGCTTCATGTCCAACAGCAGAGTTATTC
ATAAGAAATGCAGTCAGTACATCCTCTTCAAATGATCCTTCCATTCCTGGAAAGCTCCTTCGCATGGTTTTCCATGATTGCTTCGTAGAG
GTTAGTATTCAAATGTTGCTCTTCACCAAG
CAAATGACATTCTGTGAGAGTTTATAGAAACAAGTTATGCCATGTGCATAAGCTCTCTTAAATAGCTTATAAAAACGGTTTGACTTTATTTATCTTTTTATAAAGATAGCTTATACAATT
GCACTTATACGATACTCCCTCCGTCCCATAATATAAACAAAAAAACGCAATTTCTTTGTCCCAAAATATAAGAAGAAAAAAAAAACAAACTTTTATCTTTTTCAAGATTTTTTTTTTTGT
TTATTCTCATAAAAGTAAATGCAAATTACATTCAATTTTCTCTCTCTTTCATTTTTTTCTATGACGAATAGATAAAAATTTGTGATATAAGCGCTTAATTAAATTGTTTGGATCCAAACA
AGACTACTTGATGTGAGATTCAAATTGGTTTTATCTTGATAGATCTTTGTTATTTCCTCCGAATCAGTCCATGCATCACATGTTTTGATTCTAAGTGTTGGGTTGTTTTGACTTTTGAGA
GTTTCATATTGACTAGAGATATGACTTAGATAGTGCTTGTTAGGTTTGAGCAGTCCGGATCCAACAAGTCATTTTGTAGGATTTTGTCACACTCAATGTCAGAATTCTAAGATTTGAAGT
TCTGATGACCTTAGAGGTTGCATGCAATAGTGAGCTATGAACCACTAATACGATGTGTCGAGTGTCCAATACGTGTCGGTCTTTGACACTGACACGACATGCATGTGGATACACTCAATC
ACTTCAATTTTCTCAAATTATCAACTTCAGTGTCATGTTTGTTGCATCTATGTTAGTGCTTTATAGATAGTGAGGTATCATAATCGGGTACTCTGCACTTTATTTTTTACATTGGTTTAT
CAATTATGATTGTCTCCTTGATGCAATAAGATTATTATTTGAAATGCAGGGATGTGATGCATCTTTGATGCTACAAGGGAATAATACAGAACAAAGTGATCCAGGAAACAGATCTGTTGG
TGGATTTTCTGTTATAGAAACAGCGAAAAGAGTTCTTGAGATGTTCTGCCCAGGAACTGTTTCTTGTGCAGACATAATTGCTCTAGCAGCTAGAGATGCAGTTGAAATT
GTAAGTTCTCC
ATTGCACTTCTTATACTATCCTTCAATCAGAAATAGACATGTCTTTTTGGTACTGTTGTTGAAAGACACTTTGTGAAACAGGCTGGTGGACCAAGGGTTCAGATTCCTACAGGTAGGAGA
GATGGAATGGTTTCAATTGCTTCAAATGTTAGACCCAACATTGTGGACACTAGTTTTACTATGGACGAGATGCTTAAGCTCTTTTCCAGTAAAGGATTGTCCTTACTTGATCTTGTGGTT
CTTTCAG
GTTCATAATATAAACCCAAATCTATATCTATATTATTTACATTTTAGAATTTACCAAGACTTGAACATAGTACTAGTATTTTTTTTTTTTATTTCAAGTAAAATTCCATAAAG
TAACACATTTTGGTCGGTAGAAATAATTAAACTATAGATGCTTTGTAGATGATATCATCTAATCAAATTTGTTATAATTGCCATCTTGACATGTTGAGAGTACTACGTTGGATAGTAATA
TGATCTGAACGATGATTATAGTTGAAGGCAACCGTCATTCCATGTAGTAGTTTTTGAGGTTGAACAAAGAATTATAATTCTGATATGGTAAACAAAGTATAGCCTATTGAGCCATCCACA
TATATCTAGTAGTTTATACACTCCAGATGTCTAGTCTCTGGCTTGAGGAATGTGTTGAGAGTCCTTCAAGCCGGTTTTTTGAATATTTTGAGTCCGGTCCAATTTTTAAAACATTAGTTG
GCCTATTTCTCTTTCTAACTTTTGGGTATTCAAACCAAGTGTATTAGACAAAAATATCTCATGCTTTATTTGATTGTCTGCTTCTTCTCACTATATTTACTTTAATATCTAACTAGTGTT
ACATATTTAGTACTAATTGTTAAGCTTTGCAGGGGCTCATACAATAGGAACAGCTCATTGCAATACATTCAGGGGTCGTTTCCAACAAGACAGAAATGGAAGTCTTAGGCTCATTGACCA
AACCATTGATACTAATTATGCTGATCAGCTAATAAAACAGTGTCCAATAAATGCACAACCATCCGTGGCAGTGAACATCGATCCTGAAACATCTATGCTATTTGACAACCAATACTACAG
AAATCTTCTTGATCGCAAAGTTCTGTTCCAGTCTGATTCGGTTTTGATGAACAATGATGACACGAGGAAACTAGTGGAGGATTTTGCAAATGATCAAGAACTTTTCTTTGACAATTGGGG
TGTGTCGTTCGTAAAGCTAACCAGTATTGGGGTAAAAACTGACGAGGAGGGTGAAATTCGACGTTCTTGTGCTGCAACTAATATTGTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGACAACAAAATCAATGTTTCTTTTCATAGCAGTTTCTATCTTGTTTGTTTCCTCTGTAACTGCTAATCTTGCTTTCGACTTCTATGCTGCTTCATGTCCAACAGCAGAGTTATTC
ATAAGAAATGCAGTCAGTACATCCTCTTCAAATGATCCTTCCATTCCTGGAAAGCTCCTTCGCATGGTTTTCCATGATTGCTTCGTAGAG
GGATGTGATGCATCTTTGATGCTACAAGGG
AATAATACAGAACAAAGTGATCCAGGAAACAGATCTGTTGGTGGATTTTCTGTTATAGAAACAGCGAAAAGAGTTCTTGAGATGTTCTGCCCAGGAACTGTTTCTTGTGCAGACATAATT
GCTCTAGCAGCTAGAGATGCAGTTGAAATT
GCTGGTGGACCAAGGGTTCAGATTCCTACAGGTAGGAGAGATGGAATGGTTTCAATTGCTTCAAATGTTAGACCCAACATTGTGGACACT
AGTTTTACTATGGACGAGATGCTTAAGCTCTTTTCCAGTAAAGGATTGTCCTTACTTGATCTTGTGGTTCTTTCAG
GGGCTCATACAATAGGAACAGCTCATTGCAATACATTCAGGGGT
CGTTTCCAACAAGACAGAAATGGAAGTCTTAGGCTCATTGACCAAACCATTGATACTAATTATGCTGATCAGCTAATAAAACAGTGTCCAATAAATGCACAACCATCCGTGGCAGTGAAC
ATCGATCCTGAAACATCTATGCTATTTGACAACCAATACTACAGAAATCTTCTTGATCGCAAAGTTCTGTTCCAGTCTGATTCGGTTTTGATGAACAATGATGACACGAGGAAACTAGTG
GAGGATTTTGCAAATGATCAAGAACTTTTCTTTGACAATTGGGGTGTGTCGTTCGTAAAGCTAACCAGTATTGGGGTAAAAACTGACGAGGAGGGTGAAATTCGACGTTCTTGTGCTGCA
ACTAATATTGTA

Retrieve as FASTA