Entry information : MtPrx[P]119 ( Medtr7g072490.1 [4.0])
Entry ID 10060
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Catherine Mathe
Last annotation changes 2016-04-12 (Catherine Mathe)
Peroxidase information: MtPrx[P]119 ( Medtr7g072490.1 [4.0])
Name (synonym) MtPrx[P]119 ( Medtr7g072490.1 [4.0])
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx[P]119
start..stop
S start..stop
MtPrx33 340 1.4e-119 1..200 70..301
MtPrx36 294 2.61e-101 1..197 66..294
GmPrx188 285 1.01e-97 1..200 70..301
LjPrx10 281 3.06e-96 1..200 70..301
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10060' 'join(26953194..26953385,26954798..26954899,26955054..26955131,26955133..26955360)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26953194..26953385 190 N° 2 26954798..26954899 100 N° 3 26955054..26955131 76 N° 4 26955133..26955360 226
join(26953194..26953385,26954798..26954899,26955054..26955131,26955133..26955360 )


exon

Literature and cross-references MtPrx[P]119 ( Medtr7g072490.1 [4.0])
DNA ref. Phytozome 12:   chr7 (26953194..26955360)
Cluster/Prediction ref. Phytozome Gene 12:   31081628 [Incorrect prediction]
Protein sequence: MtPrx[P]119 ( Medtr7g072490.1 [4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   200 (666)
PWM (Da):   %s   21639.76 (71734.9)  
PI (pH):   %s   4.58 (4.42) Peptide Signal:   %s   cut: 22 range:22-687
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCDASVLLDDTSSFIGEKTAGPNANSLRRFDVIDKIKSEIEKLCP
NTVSCADILVVAARDSVIA
LGGPSWTVQLGRRDSTTASFSLANLDLPGPSSDLGSHTIGEASCRFFRTRIYNENNIDSSTIGDLNLSPLDTITPETFDIAYFKNLQNQKGLFHSDQVLFDEETTKSQVNSYVRNSLSFR
ADFANSMIKMGNIGLL

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' end and 3' end are missing; Gaps in frame). Incorrect prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGATGTGATGCATCAGTACTGTTGGACGATACATCAAGTTTCATAGGTGAAAAAACAGCAGGTCCAAATGCTAATTCATTGAGACGCTTTGATGTAATTGACAAAATAAAGTCTGAAATA
GAGAAGTTATGCCCTAATACTGTCTCTTGTGCTGATATTCTTGTTGTGGCAGCAAGAGATTCCGTGATTGCT
CTGTAAGTATAAATACTTCAAATCAAAACTTTTCTTTAAGGGATACTT
CAAGCTAAAAAATAGAGTTTTTCGTCATAATTTTTAATTCAACGGTTGATATATGATGATAATGGATCATGACTCATATTGTATGTGTCTATATATTATTTGACTATAAACATAACTATT
TTTGAAGTCAGACATGCGAGTGGTTGTGATATGTCAGCCGTATAAAACTTTTTAAGGATATAATTAAAAATATATTTTTGGTAGGATGGTTATGGTGTACTCTCTGGTGGTTCGGGAGTT
GAGGAGTGCCTGAGTGATTCGTCTCTGGGGTAGGTATGGTGTGTCGATCGCTTTTACTTAGAGATTGGGAGTCAATTTCTAGAAATTTGTTATGTGGGCTTATTATGGTGTCTTCTTCGG
CGGAATGGGGATCGATTGGTGGTGCAATTTGTATCGGTGCTGGATTAAGTGTTTATCAGGTGTTTATTTGGGCTCGACGTCGGATAGAGAAGGTGTTTGATGAGTTTTTGGAGATTTTCG
TGCGAGTAGCAGACGTCAGGTGTTTGGAACGAGTTTAGGTGGACATTCCAGCGGACCAGTGGCGGATCTCTATAGAGACCCACAGGTGCCATGACACCCCTCAACTTATCTATAAATACT
ATATTACTCATAACATATTATAAGTATTTCATTGTCGCAGCGGAAAGTGAAGGCTTTTTGCAACTATAGGTCGCGAGTTCAATTTCTATTGGCTCCCTTTTATGTGTATTTTTATTTTTA
TTAAAACAAAGTGTTTGTCTGGAGCTCGAACCAGTGTCCACAAGGTACTGGGCATAAACAAAGTGAACCACTACACCATCTTACAAACAATGTCAAACATTTGAAAGAGTGTGTATATTT
TCTACGACTATTTGGCACCCCGAACAAAATCAGTCAAGATCCGCCACTGCAGTGGAGGTCGGGTGTTTGGAGAGTTTAGGTGGACATTCGAGTAGGAGCATGAGGTTTTCCCTCAACTTA
GGTTTTTCAGTTGTCTGAGGTTTGGCGTTGATTTTTATGTGTTGGTTTTCGTCTTGGTGGTTAGTTTTTATTGGGTTTGGTGATAGACGTCAATTAAATGATGTCTTTATTATGTAGGAG
CTTACTTTTAGCCCTTTACTTATTTCTGTCTTGCCAATCTCTATTCTTCTTGAACAGTGATCTGGTTTTAATAAATTTTGTTGTTTAATTTTTTTTTATATAAGTTGAACATACAAGTAA
TTTTACATTGCCGGTATAAAACTTTTTACAACAACAATGTATGAAAATTAATCACATATTATAAGGAAAAGAAAATTTTTGTAGTTCTTGACAAAAACAAAATTGTACTTGAAGTTATAG
TCAACCAAGTATTTCTCTATACACTAACATATTGAACACATTTCAGCTTGGTGGTCCTAGTTGGACTGTTCAATTAGGAAGAAGGGATTCAACCACAGCAAGTTTTAGTTTAGCTAACTT
AGACTTGCCAGGTCCTTCCTCTGATTTA
TAATGAATTGATTGCTCTTTCAGGTAGCAAGCTAAACTTATAGATGCATATTTATCAAATGTTTTAGATTATTATTTTTATTATTACTAGCG
CACTCTCGTGTTCGTCTATCCGGTTTTTATACCATTGTTGTGTAACTAACCTTATTGTATTATAGGATCACACACAATTGGTGAAGCTAGTTGTAGATTCTTCAGAACAAGGATTTACAA
TGAGAACAACATAGATTCATCT
CTTACAATTGGTGATTTAAATTTGTCACCGCTTGACACCATCACTCCAGAGACATTTGACATTGCTTATTTCAAGAACTTGCAAAATCAAAAGGGTCT
CTTTCACTCTGATCAAGTGCTTTTCGATGAAGAAACCACAAAATCACAAGTTAATTCTTATGTTAGGAACTCTTTAAGTTTCAGAGCTGATTTTGCCAATTCAATGATCAAAATGGGGAA
CATTGGCCTACTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGATGTGATGCATCAGTACTGTTGGACGATACATCAAGTTTCATAGGTGAAAAAACAGCAGGTCCAAATGCTAATTCATTGAGACGCTTTGATGTAATTGACAAAATAAAGTCTGAAATA
GAGAAGTTATGCCCTAATACTGTCTCTTGTGCTGATATTCTTGTTGTGGCAGCAAGAGATTCCGTGATTGCT
CTTGGTGGTCCTAGTTGGACTGTTCAATTAGGAAGAAGGGATTCAACC
ACAGCAAGTTTTAGTTTAGCTAACTTAGACTTGCCAGGTCCTTCCTCTGATTTA
GGATCACACACAATTGGTGAAGCTAGTTGTAGATTCTTCAGAACAAGGATTTACAATGAGAACAAC
ATAGATTCATCT
ACAATTGGTGATTTAAATTTGTCACCGCTTGACACCATCACTCCAGAGACATTTGACATTGCTTATTTCAAGAACTTGCAAAATCAAAAGGGTCTCTTTCACTCTGAT
CAAGTGCTTTTCGATGAAGAAACCACAAAATCACAAGTTAATTCTTATGTTAGGAACTCTTTAAGTTTCAGAGCTGATTTTGCCAATTCAATGATCAAAATGGGGAACATTGGCCTACTT

Retrieve as FASTA