Entry information : AacuGPx01
Entry ID 10062
Creation 2012-01-04 (Passaia Gisèle)
Last sequence changes 2012-01-04 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: AacuGPx01
Name AacuGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus
Organism Aspergillus aculeatus    [TaxId: 5053 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AacuGPx01
start..stop
S start..stop
MrubGPx01 254 6.58e-88 1..170 1..171
TaurGPx01 254 6.59e-88 2..168 3..169
NfGPx 255 2.02e-87 2..168 48..214
AorGPx 252 4.18e-87 1..168 1..169
Gene structure Fichier Exons


exon

Literature and cross-references AacuGPx01
DNA ref. JGI genome:   scaffold_8 (169154..168575)
Protein sequence: AacuGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171 (377)
PWM (Da):   %s   19548.82 (40479.8)  
PI (pH):   %s   8.8 (4.72) Peptide Signal:   %s   cut: 19 range:19-395
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASEMFYQFSPLDKRGKPYPLSTLRGKVVLVVNTASKCSFTPQYQELEHLYRQINSEYPNDFVVLGFPCNQFGNQDPGTNDEIQTFCQVNYGVSFPVLGKVDVNGPNADPLWSWMKNRQP
GIFGLTRIKWNFEKFLITADGQVAGRWWSMVKPQSLSDTIVREIKAGRDRL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). NO ESTs. Strain ="ATCC16872"
DNA
Send to BLAST
CDS
Send to BLAST