Entry information : VvPrx[P]101
Entry ID 10086
Creation 2012-01-05 (Qiang LI)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-01-17 (Christophe Dunand)
Peroxidase information: VvPrx[P]101
Name VvPrx[P]101
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Vitaceae Vitis
Organism Vitis vinifera (Grape)    [TaxId: 29760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VvPrx[P]101
start..stop
S start..stop
VvPrx[P]74 127 3e-41 1..68 1..77
VvPrx[P]73 125 2e-40 1..68 3..80
VvPrx92 123 3e-39 1..68 3..79
VvPrx[P]70 122 6e-39 1..68 1..77
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15687116..15687205 90 N° 2 15687224..15687340 117  
join(15687116..15687205,15687224..15687340)


exon

Literature and cross-references VvPrx[P]101
DNA ref. Phytozome 12:   chr2 (15687116..15687340)
Protein sequence: VvPrx[P]101
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   68
PWM (Da):   %s   7361.58  
PI (pH):   %s   4.48
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
EIISTKEINDPTIATATLRLFFHDCMVEGYSFNTTQHDVDINLSLPGNTVSIHPDCTSLASPVISHHS*

Retrieve as FASTA  
Remarks Pseudogene from genomic (Short PS). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGATCATAAGCACCAAGGAAATCAACGACCCCACCATAGCTACTGCCACTCTCCGCCTCTTCTTCCACGACTGCATGGTCGAAGGCTACAACGCCTCAGTCCTCATCTCCTTCAACACC
ACCCAGCACGACGTCGACATCAACCTCTCCCTCCCAGGCAATACTGTATCAATACATCCAGATTGTACGAGTCTTGCCTCTCCAGTCATCAGTCATCATTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGATCATAAGCACCAAGGAAATCAACGACCCCACCATAGCTACTGCCACTCTCCGCCTCTTCTTCCACGACTGCATGGTCGAAGGCTACTCCTTCAACACCACCCAGCACGACGTCGAC
ATCAACCTCTCCCTCCCAGGCAATACTGTATCAATACATCCAGATTGTACGAGTCTTGCCTCTCCAGTCATCAGTCATCATTCATGA

Retrieve as FASTA