Entry information : SturGPx01
Entry ID 10098
Creation 2012-01-05 (Passaia Gisèle)
Last sequence changes 2012-01-05 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: SturGPx01
Name SturGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Setosphaeria
Organism Setosphaeria turcica    [TaxId: 93612 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SturGPx01
start..stop
S start..stop
PtritGPx01 332 1.78e-117 1..168 104..271
PterGPx01 331 4.96e-117 1..169 101..269
ClunGPx01 325 3.26e-116 1..167 1..167
AalteGPx01 325 2.94e-115 1..169 72..240
Gene structure Fichier Exons


exon

Literature and cross-references SturGPx01
DNA ref. JGI genome:   scaffold_11 (1622791..1621884)
Protein sequence: SturGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18772.63  
PI (pH):   %s   8.79
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFYDFKPKDKKGEPYDLSKLNGKVVLVVNTASKCGFTPQFEGLEKLYKELKAKHPNDFEILGFPCNQFGGQDPGSNDEIQTFCQVNYGVSFPVLGKIDVNGATADPAFEWLKNEK
PGLMGLKRVKWNFEKFLVGRDGKVKGRWASTKKPDDLKAEIEKELNAK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_11, 2 introns). No EST.
DNA
Send to BLAST
CDS
Send to BLAST