1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx20 (At2g35380 / PER20 / AtperoxP20 / ATP28a)
Entry ID 101
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtPrx20 (At2g35380 / PER20 / AtperoxP20 / ATP28a)
Name (synonym) AtPrx20 (At2g35380 / PER20 / AtperoxP20 / ATP28a)
Class Class III peroxidase    [Orthogroup: Prx043]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Callus
Mixed tissues
Roots
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx20
start..stop		 S start..stop
AhalPrx14 667 0 1..336 1..336
AlyPrx20 653 0 1..336 1..336
CrubPrx116 645 0 1..336 1..337
CagraPrx24 642 0 1..336 1..337
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx20 (At2g35380 / PER20 / AtperoxP20 / ATP28a)
Protein ref. UniProtKB:   Q9SLH7
DNA ref. Phytozome 12:   Chr2 (14892636..14893958)
mRNA ref. GenBank:   NM_129090.3
Cluster/Prediction ref. Phytozome Gene 12:   19643048 UniGene:   At.89
Omic ref. AtProteome:   At2g35380 ATTED-II:   At2g35380 e-FP Browser:   At2g35380 ePlant:   At2g35380 Genevestigator:   At2g35380 TAIR:   At2g35380
Protein sequence: AtPrx20 (At2g35380 / PER20 / AtperoxP20 / ATP28a)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (312)
PWM (Da):   %s   37840.37 (35125.8) Transmb domain:   %s   i7-24o
PI (pH):   %s   5.11 (4.88) Peptide Signal:   %s   cut: 25 range:25-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEIKQKKVWLSLIVLYAITTSVLGDFGEPLLKGFYKESCPLAEEI
VKHNIEVAVLKDPRMAASLLRLQFHDCFVLGCDASVLLDTHGDMLSEKQATPNLNSLRGFEVIDYIKYLLEEACPLTVSCSDILALAARDSVFLRGGPWWEVLLGRRDSLKASFAGANQFIPAPNSSLDSLIINFKQQGLNIQDLIALSG
AHTIGKARCVSFKQRIVQPNMEQTFYVDEFRRHSTFRRVLGSQCKDSSRDNELSPLDIKTPAYFDNHYFINLLEGRGLLISDNVLVSEDHEGEIFQKVWEYAVNQDLFFIDFVESMLKMG
NINVLTGIEGEIRENCRFVNI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1 and 2), 5 cDNA and 7 ESTs.
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST