Entry information : SrosGPx01
Entry ID 10101
Creation 2012-01-05 (Passaia Gisèle)
Last sequence changes 2012-01-05 (Passaia Gisèle)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-27 (Catherine Mathe (Scipio))
Peroxidase information: SrosGPx01
Name SrosGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Sporobolomyces
Organism Sporobolomyces roseus    [TaxId: 40563 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SrosGPx01
start..stop
S start..stop
RgraGPx01 238 1.82e-81 31..193 1..157
PcGPx 199 2.97e-66 34..191 1..159
CputGPx01 201 1.25e-65 31..193 105..268
BaGPx01 199 1.63e-65 7..191 28..213
Gene structure Fichier Exons


exon

Literature and cross-references SrosGPx01
DNA ref. JGI genome:   scaffold_1 (2151229..2152062)
Protein sequence: SrosGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   194
PWM (Da):   %s   21692.07  
PI (pH):   %s   8.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLRSSFALSRTLVSSNPLASPLVPHRLYTVMASVASFFDLKAEKKNGEFLDFKDHEGKAFLVINTATHCGFTKQFSELEALHQKYKDQGLVVLGFPCDQFGNQNKEDDEGTESFCKLNYG
VSFPLMKKSDVNGDKTNDVFAYLKPRAKGLLGERVNWNFSKFLINRKGEVLHRYAPTTAPSSLEKDIEKALASA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_1:2151319-2152062 (+), 3 introns) No EST.
DNA
Send to BLAST
CDS
Send to BLAST