Entry information : FcylCP02 (CAT 2)
Entry ID 10120
Creation 2012-01-06 (Christophe Dunand)
Last sequence changes 2012-01-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-17 (Christophe Dunand)
Peroxidase information: FcylCP02 (CAT 2)
Name (synonym) FcylCP02 (CAT 2)
Class Catalase peroxidase    [Orthogroup: CP002]
Taxonomy Eukaryota Bacillariophyta Bacillariophyceae Bacillariaceae Fragilariopsis
Organism Fragilariopsis cylindrus    [TaxId: 186039 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FcylCP02
start..stop
S start..stop
PiCP01 466 7.79e-154 146..757 59..686
HaraCP01 457 4.12e-150 146..757 56..683
SarcCP01 452 1.9e-148 154..756 62..667
PcapCP02 449 2.33e-147 146..757 56..683
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10120' 'join(891702..891709,891864..892372,892522..892670,892839..893079,893196..893366,893512..893683,893918..893968,894078..894295,894418..894597,894714..894997,895121..895425,895557..895833,896088..896144) ' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 891702..891709 6 N° 2 891864..892372 507 N° 3 892522..892670 147 N° 4 892839..893079 239
N° 5 893196..893366 169 N° 6 893512..893683 170 N° 7 893918..893968 49 N° 8 894078..894295 216
N° 9 894418..894597 178 N° 10 894714..894997 282 N° 11 895121..895425 303 N° 12 895557..895833 275
N° 13 896088..896144 55  
join(891702..891709,891864..892372,892522..892670,892839..893079,893196..893366, 893512..893683,893918..893968,894078..894295,894418..894597,894714..894997,89512 1..895425,895557..895833,896088..896144)


exon

Literature and cross-references FcylCP02 (CAT 2)
DNA ref. JGI genome:   scaffold_25 (891702..896144)
EST ref. GenBank:   GW072230.1 [3' end]
Cluster/Prediction ref. JGI gene:   249103
Protein sequence: FcylCP02 (CAT 2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   873 (854)
PWM (Da):   %s   95149.86 (93073.7)  
PI (pH):   %s   4.17 (4.15) Peptide Signal:   %s   cut: 20 range:20-873
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLSALSLTAFLQIGSTSAGCPLAHLHESAEGGVSIANPHIALANQHSLQVHKTPLVHFKIPPKDRHHSSAAPGFEIVMEGGVLVEKKKKENKDGKKNDDRDLQELKQIKQEWDLLDIMS
PESTLDEPSYSNQNVGDGFAKPVGGYSAVRQDVIDMVLTSNQAFWPADILPPDGPNYSGLLIRLAWHCAGTYRTSDGRGGCDGAAIRFPPESNWKDNKSLDEAMQLLIPIKEKHGDKLSW
GDLIVIAADAAIISMGGPVIGFCGGRIDFQNGDQSLPLGPSSIQQQFMPCGPEQCPVGEVCPGCESPLGTAAQGLMYVNAEGTPVGEFEGTADNIREVFARMGFNDRMTVAAIGGGHAFG
KCHGPCIEDEIIETFCPDKDTNSYEPPYTWEQKYTSGLEVTWTTTPTSWDNEFFNNILDFTWANITGPGGRLQWEPEEVTAPNIQMLTTDLALVYGDAEYRMISQEYATNLNSLTADFGT
AWYQLMTRDTGNRQRCLGDELPPIQPWELAMGPLGPLTTPKPDYIPVRSAIQKSIDEKPSNIAAFATLASQCATTFRSTDYLGGCNGAAIRYSPSIDWPTNTGAVDYLKLLEPIKDEFSE
VSWSDLIVLAGQTAIEAAGGYPMPFCGGRSDSDKGDKSIGLEPRIYNNNKYDSIMYDITNKGLSLAEGVALMATPDPIIAELVNLEAGVTASTRANKSTYTLSNQFFVRMNETDEDVMEW
YKGDIADIGEQFINDNDYFLEQYSKAYTYLMTADLFDGPTKNACQKVDDPTIQGDTPKPTDPPGLDDDGDDTYDDDVSEPIERQTATPTKTGIYVFSYDDSDATTTPPIDDSAANNNHAT
SLSSAFAAIVAVVWMIVARVMGDMYGNDEDVNR*

Retrieve as FASTA  
Remarks Complete sequence from genomic (12 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAACTCTGTAAGCCAAGTCAAGTGTAGTCAAGTGTGAAGTGTCGTGCTCAGCAGTTCTTTTGTGTTTTCATTGTCTGCGTCGTCTATCAATCTCATCTTTTCTTCTTCTTTTCCTTT
CTATCTTCCGTATATAACAAACAAATAAATAAATAAATATAAAGATCGGCTCTATCATTGACGGCATTCCTCCAGATTGGTTCCACCTCAGCAGGATGTCCATTAGCACATCTACATGAA
AGTGCAGAGGGAGGTGTATCTATTGCGAATCCACATATTGCTTTAGCCAATCAGCATTCATTACAGGTACATAAAACACCACTGGTTCATTTCAAGATCCCACCAAAAGATCGTCATCAT
TCCTCCGCCGCGCCTGGTTTTGAAATTGTGATGGAGGGTGGTGTACTGGTAGAAAAGAAGAAGAAAGAAAACAAAGACGGGAAGAAGAATGATGATCGAGATTTACAAGAATTAAAACAA
ATAAAACAAGAATGGGATTTATTAGATATTATGTCTCCAGAATCTACATTAGATGAGCCATCGTATTCGAATCAAAATGTTGGTGATGGGTTTGCAAAACCCGTCGGGGGATATAGTGCT
GTACGTCAAGATGTGATTGATATGGTATTAACAAGTAATCAAGCGTTCTGGCCAGCTGATATTTTACCACCCG
CGGTACGTATAATACTAGTATGTATTTATACATTTATCCTTCTTTCC
ACACCACACCACACCACACCAACAATCACCTTTATCTCAAAAATCAATGTACAATTCCTCTCCTTTTTTTTTCTTCTTCTTTACTCTCTTCCTCTAATACATAGACGGTCCAAATTATTC
TGGTTTATTAATTCGATTAGCATGGCATTGCGCTGGTACATACCGTACTAGTGATGGTCGAGGTGGATGTGATGGTGCTGCGATCCGATTTCCACCTGAAAGTAACTGGAAAGATAATAA
ATCATTAGATGAG
AGGTACGTTAAAGAAAAGTGGTGTGGCATTTTTGTGTGCATGCATTACAACGAACGAACCTACGATCGATTGAGTAGCAAAACAAAACAAACCAAAAAAATCATTAC
ATAACCTTACATACGTATCTGGTGCAAAATTCTTTTCATCTTATCCTATATATACTACCGTAGGCAATGCAATTATTAATTCCTATAAAAGAAAAACATGGTGATAAGCTATCATGGGGA
GATTTAATTGTTATAGCAGCTGATGCTGCTATTATATCAATGGGTGGACCAGTGATTGGATTTTGTGGTGGACGCATCGATTTTCAGAATGGTGATCAATCACTCCCTCTCGGTCCATCT
TCTATACAACAACAGTTTATGCCATGTGGACCAGAACAATGTCCAGTCGGTGAAGTATGTCCCG
CGGTACGTTACGTTACGTCAGTAAATGTCATTTCCTCCTTCCATGTCACTTCAACA
CAATCCCCGTCGTCTCACAAAAATAAATCGATATACATTTTTTCTCTCTCTTTCTGTCTCAGGATGTGAATCACCATTAGGTACAGCAGCTCAAGGATTAATGTATGTTAATGCAGAAGG
TACACCAGTAGGTGAATTTGAAGGTACTGCTGATAATATACGTGAAGTATTTGCACGTATGGGATTTAATGATCGTATGACTGTTGCAGCTATTGGTGGTGGGCATGCATTTG
TGGTAAG
CAAAAAAAAAACTCAGCTACAACACAACAACGTTAGCAACAATTTGGTTAATAACCTACCCTAACACACCCATAATACACACCGACTTACTTAACTCACACACATAATTTATTTACATAT
CGTCACAATTGTTACAATAGGTAAATGTCACGGTCCATGTATTGAGGATGAAATTATTGAAACATTTTGTCCAGACAAAGATACAAATTCATACGAACCACCATATACATGGGAACAAAA
ATATACATCAGGATTGGAAGTAACATGGACAACAACACCAACATCTTGGGACAATGAATTCTTTAATAACAT
ATGTAAGTATTACTACGGACGACAAGTCGTCTTAATACTGTATTCGTT
TCCTCGTTTCTTAGTCAGTGGCAGCGTCGTCATATCACGAGAATATCTGTCAAAAACGCACTTTTCTTACCTTGAAGGCACTATAAGTCATAAATCATATTTCTATCTTATTCCTTCTCT
CACCCCATGCGATATCCTCTAAACTTTATCCACCGTCTGATCATGTTATTTATACTATTCACATACAGTCTCGATTTTACTTGGGCTAATATCACCGGTCCAGGAGGGCGTTTACAATGT
GGTAAGTCTTATAAGCGTGCTAATAAATGTTCGTTCTTTTGAGTGGCTACAGACAATTTTCTAATTTTCTTTTCCTTTCTTCCATCTTCGTTTTCATTTTCTTGATTAAGGGAACCAGAA
GAAGTAACTGCACCTAATATTCAAATGCTGACAACCGATCTTGCTTTGGTGTACGGTGACGCAGAGTACAGAATGATTTCTCAAGAGTACGCTACGAATCTTAATTCTCTCACCGCTGAT
TTTGGTACAGCGTGGTATCAATTAATGACACGTGATACTGGTAACAGACAAAGATGTTTGGGTGATGAACTTCCTCCAATCCAACCAT
ATGTAAGTCTTTTTTTTCTAAGATCTCAAATC
GTTGTTGTCATATGCAAGTCAATGAGATGACGATCTTGATTACTCGAATCCTTTGTCTCTAACACGATTCTCTTAACTATCTATCTTTATAGGGGAATTGGCGATGGGTCCATTAGGTCC
ATTAACAACACCCAAACCAGATTATATCCCTGTTCGATCTGCTATTCAAAAATCTATTGATGAGAAACCGTCGAATATTGCAGCATTTGCTACCTTAGCAAGTCAATGCGCAACAACATT
CCGTTCTACTGATTATCTTGGTGGATGTAATG
TGGTACGTCGTTACGTTATGGATTATTATTACGGGTTGTTATCGTTATCACAACACGAACAACACTAACTTTTCGACATTCTTGTATT
CGGTGTTTTTATCTTTAAAAATAATAATAGGTGCGGCTATCCGCTACTCTCCATCTATTGATTGGCCGACAAATACAGGTGCTGTTGATTATTTGAAATTATTAGAACCAATCAAAGATG
AATTCTCTGAAGTATCTTGGTCGGATCTTATTGTTTTAGCAGGACAAACTGCCATTGAAGCTGCTGGGGGATATCCAATGCCATTCTGCGGGGGTCGTTCCGATTCAGATAAAGGAGATA
AATCTATTGGATTAGAACCAAGAATTTACAACAACAACAAGTATGATTCGATCATGTACGATATTACCAACAAG
AGGTAAGTATATATTGATTATGTATTTATCTTGTTTTATTTAATTT
CATTCTTCGCTCATTTCAATCAATATATATTTTCCCATATCCATGCATATACACACTATCGCTCTATCTCTATGAACAGGGTTTATCGTTAGCGGAAGGCGTCGCTCTCATGGCAACACC
TGATCCTATCATTGCTGAGCTTGTTAATTTAGAAGCCGGCGTTACCGCTTCCACTCGCGCGAACAAGAGCACCTACACTTTGTCGAATCAATTCTTTGTACGTATGAACGAAACAGATGA
GGATGTGATGGAATGGTATAAAGGTGATATAGCTGATATTGGGGAACAATTTATCAACGACAATGATTACTTCTTGGAGCAGTACTCAAAAGCGTACACTTACTTAATGACAGCAGATTT
ATTTGATGGACCAACAAAGAATGC
GCGTAAGTTCAAACAGAACAAAACGGTACATTGTAGATTTTTCTGATCCGAAGCTACGTTAGACTAATATGATTTTTTTTTTTCTCTTTTTGATCA
TTTTTCGGAACTCGTTTGTGGTCCTTTCTTCATGCAGATGTCAAAAAGTGGATGATCCAACGATTCAGGGAGATACTCCGAAGCCTACCGATCCACCTGGTTTAGACGATGATGGAGACG
ACACTTATGATGATGACGTCAGTGAGCCCATCGAACGGCAAACTGCCACGCCCACCAAAACAGGCATATACGTTTTCTCGTACGATGACAGTGACGCTACTACCACCCCTCCTATTGACG
ATAGTGCCGCCAATAACAATCACGCCACTTCTCTTTCGTCTGCTTTCGCTGCTATCGTAGCAGTAGTATGGATG
TGGTAGTCTAAAGATAATAACTATACCACGTGCATAATTGCATCTA
ATCATTTTTATCATCAGAAGTAGACATGTGGGGCTATGAAAACAAAAGAAGAAGTAGAAAAAAGAGCTAAGACAACCAACGATTTTGCAGCATTATAGTGTAGGACCTCACACCCACATT
AGTACATCTAAATATTTACATATAATTAATTACATATATATCATTAATAGTTTGCGACTTATTTATATATCATCTTTACTATTCCATTAGATAGTAGCTCGCGTTATGGGTGATATGTAC
GGCAACGATGAAGATGTAAATAGATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAACTATCGGCTCTATCATTGACGGCATTCCTCCAGATTGGTTCCACCTCAGCAGGATGTCCATTAGCACATCTACATGAAAGTGCAGAGGGAGGTGTATCTATTGCGAATCCACAT
ATTGCTTTAGCCAATCAGCATTCATTACAGGTACATAAAACACCACTGGTTCATTTCAAGATCCCACCAAAAGATCGTCATCATTCCTCCGCCGCGCCTGGTTTTGAAATTGTGATGGAG
GGTGGTGTACTGGTAGAAAAGAAGAAGAAAGAAAACAAAGACGGGAAGAAGAATGATGATCGAGATTTACAAGAATTAAAACAAATAAAACAAGAATGGGATTTATTAGATATTATGTCT
CCAGAATCTACATTAGATGAGCCATCGTATTCGAATCAAAATGTTGGTGATGGGTTTGCAAAACCCGTCGGGGGATATAGTGCTGTACGTCAAGATGTGATTGATATGGTATTAACAAGT
AATCAAGCGTTCTGGCCAGCTGATATTTTACCACCCG
ACGGTCCAAATTATTCTGGTTTATTAATTCGATTAGCATGGCATTGCGCTGGTACATACCGTACTAGTGATGGTCGAGGTGGA
TGTGATGGTGCTGCGATCCGATTTCCACCTGAAAGTAACTGGAAAGATAATAAATCATTAGATGAG
GCAATGCAATTATTAATTCCTATAAAAGAAAAACATGGTGATAAGCTATCATGG
GGAGATTTAATTGTTATAGCAGCTGATGCTGCTATTATATCAATGGGTGGACCAGTGATTGGATTTTGTGGTGGACGCATCGATTTTCAGAATGGTGATCAATCACTCCCTCTCGGTCCA
TCTTCTATACAACAACAGTTTATGCCATGTGGACCAGAACAATGTCCAGTCGGTGAAGTATGTCCCG
GATGTGAATCACCATTAGGTACAGCAGCTCAAGGATTAATGTATGTTAATGCA
GAAGGTACACCAGTAGGTGAATTTGAAGGTACTGCTGATAATATACGTGAAGTATTTGCACGTATGGGATTTAATGATCGTATGACTGTTGCAGCTATTGGTGGTGGGCATGCATTTG
GT
AAATGTCACGGTCCATGTATTGAGGATGAAATTATTGAAACATTTTGTCCAGACAAAGATACAAATTCATACGAACCACCATATACATGGGAACAAAAATATACATCAGGATTGGAAGTA
ACATGGACAACAACACCAACATCTTGGGACAATGAATTCTTTAATAACAT
TCTCGATTTTACTTGGGCTAATATCACCGGTCCAGGAGGGCGTTTACAATGGGAACCAGAAGAAGTAACT
GCACCTAATATTCAAATGCTGACAACCGATCTTGCTTTGGTGTACGGTGACGCAGAGTACAGAATGATTTCTCAAGAGTACGCTACGAATCTTAATTCTCTCACCGCTGATTTTGGTACA
GCGTGGTATCAATTAATGACACGTGATACTGGTAACAGACAAAGATGTTTGGGTGATGAACTTCCTCCAATCCAACCAT
GGGAATTGGCGATGGGTCCATTAGGTCCATTAACAACACCC
AAACCAGATTATATCCCTGTTCGATCTGCTATTCAAAAATCTATTGATGAGAAACCGTCGAATATTGCAGCATTTGCTACCTTAGCAAGTCAATGCGCAACAACATTCCGTTCTACTGAT
TATCTTGGTGGATGTAATG
GTGCGGCTATCCGCTACTCTCCATCTATTGATTGGCCGACAAATACAGGTGCTGTTGATTATTTGAAATTATTAGAACCAATCAAAGATGAATTCTCTGAA
GTATCTTGGTCGGATCTTATTGTTTTAGCAGGACAAACTGCCATTGAAGCTGCTGGGGGATATCCAATGCCATTCTGCGGGGGTCGTTCCGATTCAGATAAAGGAGATAAATCTATTGGA
TTAGAACCAAGAATTTACAACAACAACAAGTATGATTCGATCATGTACGATATTACCAACAAG
GGTTTATCGTTAGCGGAAGGCGTCGCTCTCATGGCAACACCTGATCCTATCATTGCT
GAGCTTGTTAATTTAGAAGCCGGCGTTACCGCTTCCACTCGCGCGAACAAGAGCACCTACACTTTGTCGAATCAATTCTTTGTACGTATGAACGAAACAGATGAGGATGTGATGGAATGG
TATAAAGGTGATATAGCTGATATTGGGGAACAATTTATCAACGACAATGATTACTTCTTGGAGCAGTACTCAAAAGCGTACACTTACTTAATGACAGCAGATTTATTTGATGGACCAACA
AAGAATGC
ATGTCAAAAAGTGGATGATCCAACGATTCAGGGAGATACTCCGAAGCCTACCGATCCACCTGGTTTAGACGATGATGGAGACGACACTTATGATGATGACGTCAGTGAGCCC
ATCGAACGGCAAACTGCCACGCCCACCAAAACAGGCATATACGTTTTCTCGTACGATGACAGTGACGCTACTACCACCCCTCCTATTGACGATAGTGCCGCCAATAACAATCACGCCACT
TCTCTTTCGTCTGCTTTCGCTGCTATCGTAGCAGTAGTATGGATG
ATAGTAGCTCGCGTTATGGGTGATATGTACGGCAACGATGAAGATGTAAATAGATAG

Retrieve as FASTA