Entry information : EgrPrxQ01 (Eucgr.C00774 / Egrandis_v1_0.021321m)
Entry ID 10152
Creation 2012-01-24 (Christophe Dunand)
Last sequence changes 2012-01-24 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-27 (Christophe Dunand)
Peroxidase information: EgrPrxQ01 (Eucgr.C00774 / Egrandis_v1_0.021321m)
Name (synonym) EgrPrxQ01 (Eucgr.C00774 / Egrandis_v1_0.021321m)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrxQ01
start..stop
S start..stop
EguPrxQ01 579 0 1..296 1..296
EcamPrxQ01 577 0 1..296 1..298
EglPrxQ01 539 0 29..296 1..268
PtPrxQ01 345 1.53e-121 84..295 1..212
Gene structure Fichier Exons


exon

Literature and cross-references EgrPrxQ01 (Eucgr.C00774 / Egrandis_v1_0.021321m)
DNA ref. Phytozome 12:   scaffold_3 (12898958..12900751)
EST ref. GenBank:   HS042572.1 [5' end]  HS066278.1 [3' end]
Protein sequence: EgrPrxQ01 (Eucgr.C00774 / Egrandis_v1_0.021321m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   296
PWM (Da):   %s   32459.95 Transmb domain:   %s   i57-79o
PI (pH):   %s   10.61
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLSSDNLAAYWAGQARPTEDLVQSVQFRRSGRRRRRNATLADPVASRGAQHSSKRIICLPFSLIFLGPFFFIPSSALILSSTMATLSLPKHSLPSLLPPQTPRTQSPRTPTFLPKSTQS
QFHGLKLSNSSSPSVPSSFSAKSTVFAKVNKGQAPPAFTLKDQDGKTVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYRLPFTLLSDV
GDKVRKDWGVPSDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQSA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 10 ESTs
DNA
Send to BLAST
CDS
Send to BLAST