Entry information : EgrPrxII01 ( Eucgr.A01555 / Egrandis_v1_0.051094m)
Entry ID 10155
Creation 2012-01-24 (Christophe Dunand)
Last sequence changes 2016-01-25 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-26 (Achraf Jemmat)
Peroxidase information: EgrPrxII01 ( Eucgr.A01555 / Egrandis_v1_0.051094m)
Name (synonym) EgrPrxII01 ( Eucgr.A01555 / Egrandis_v1_0.051094m)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrxII01
start..stop
S start..stop
EcamPrxII01 336 5e-119 1..212 1..224
EglPrxII01 333 1e-117 1..211 1..223
EguPrxII01 293 6e-103 76..218 1..143
PtrtrPrxII05 281 3e-97 1..218 1..218
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..224 224 N° 2 1324..1756 433  
join(1..224,1324..1756)


exon

Literature and cross-references EgrPrxII01 ( Eucgr.A01555 / Egrandis_v1_0.051094m)
DNA ref. GenBank:   NW_010092438.1 (24497686..24499441) Phytozome 12:   scaffold_1 (24499016..24499441)
EST ref. GenBank:   HS054510.1 [Fragment]
Cluster/Prediction ref. Genebank:   104455998
Protein sequence: EgrPrxII01 ( Eucgr.A01555 / Egrandis_v1_0.051094m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   218 (304)
PWM (Da):   %s   22627.11 (32842.7)  
PI (pH):   %s   9.33 (8.95) Peptide Signal:   %s   cut: 33 range:33-336
Sequence 260
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASLSISRLLTTTSATKTAAAAAAAALLPRISLSFTSLAVPRRSSLAVAVPRRPGKPLRLSTAPPPPPAPEISPGELQTTTVSALTAGKKSILFAVPGAFTPTCSQKHLPGFVEKAGELKAKGVDTIACVSVNDAFVMRAWKENLGIGDEVLLLSDGNGDFTRAIGCELDLSDKPIGLGVRSRRYALLAEDGVVKVLNLEEGGAFTFSSAEDMLKVL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (no intron) and 1 EST. Incorrect prediction from phytozome (5' end is missing due to undetermined nt).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCAGCTTCTCTCTCCATCTCCAGACTCCTCACCACCACCTCCGCCACCAAAACCGCTGCCGCCGCCGCCGCCGCCGCCCTTCTCCCTCGCATATCCCTCTCCTTCACCTCCCTCGCCG
TCCCCCGCCGCTCCTCCCTCGCCGTCGCCGTCCCCCGCCGCCCCGGCAAGCCCCTCCGCCTCTCCACCGCGCCACCCCCGCCACCCGCGCCCGAAATCTCTCC
GTGGGCGACAAGCTCCC
GGGTCGAATTCTCCTTGTCTTGTTAAAATCCCAACGGATTTTCTGCAATCTCCTTGGTCATTTCTCGCATTGTATGGAAGAACATGATAATATTTCACAATTGCTTGGCCTTCATATCGC
TTGCTATCATTTCCCCCGTTGTCCCCTTGAGGAGAATGCCGGGGAGCTCAGTGCTGAGGGGGTAGAGGATTGGCTCTGTGCCACGGGGAGTGGAAAGTCATATATTTGGCACATTTACGA
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NCCGGCGAGCTCCAGACCACCACCGTCTCCGCCCTCACCGCCGGGAAGAAGTCGATCCTCTTCGCCGTCCCGGGGGCCTTCACCCCGACCTGCTCCCAGAAGCACCTCCCGGGGTTCGTG
GAGAAGGCCGGGGAGCTGAAGGCGAAGGGGGTGGACACCATCGCCTGCGTCTCGGTGAACGACGCCTTCGTGATGCGGGCGTGGAAGGAGAACCTGGGGATCGGCGACGAGGTGCTGCTG
CTGTCGGATGGGAACGGGGACTTCACGAGGGCGATCGGGTGCGAGCTCGACCTGAGCGACAAGCCCATCGGGCTCGGGGTGCGGTCGCGGCGGTACGCGCTGCTCGCGGAGGACGGCGTC
GTGAAGGTGCTCAACCTGGAGGAAGGCGGGGCCTTCACCTTCAGCAGTGCCGAGGATATGCTCAAAGTTCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCAGCTTCTCTCTCCATCTCCAGACTCCTCACCACCACCTCCGCCACCAAAACCGCTGCCGCCGCCGCCGCCGCCGCCCTTCTCCCTCGCATATCCCTCTCCTTCACCTCCCTCGCCG
TCCCCCGCCGCTCCTCCCTCGCCGTCGCCGTCCCCCGCCGCCCCGGCAAGCCCCTCCGCCTCTCCACCGCGCCACCCCCGCCACCCGCGCCCGAAATCTCTCC
CGGCGAGCTCCAGACCA
CCACCGTCTCCGCCCTCACCGCCGGGAAGAAGTCGATCCTCTTCGCCGTCCCGGGGGCCTTCACCCCGACCTGCTCCCAGAAGCACCTCCCGGGGTTCGTGGAGAAGGCCGGGGAGCTGA
AGGCGAAGGGGGTGGACACCATCGCCTGCGTCTCGGTGAACGACGCCTTCGTGATGCGGGCGTGGAAGGAGAACCTGGGGATCGGCGACGAGGTGCTGCTGCTGTCGGATGGGAACGGGG
ACTTCACGAGGGCGATCGGGTGCGAGCTCGACCTGAGCGACAAGCCCATCGGGCTCGGGGTGCGGTCGCGGCGGTACGCGCTGCTCGCGGAGGACGGCGTCGTGAAGGTGCTCAACCTGG
AGGAAGGCGGGGCCTTCACCTTCAGCAGTGCCGAGGATATGCTCAAAGTTCTGTAG

Retrieve as FASTA