Entry information : EgrDiOx01 (Eucgr.K02262 / Egrandis_v1_0.007021m)
Entry ID 10157
Creation 2012-01-25 (Qiang Li)
Last sequence changes 2012-05-23 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrDiOx01 (Eucgr.K02262 / Egrandis_v1_0.007021m)
Name (synonym) EgrDiOx01 (Eucgr.K02262 / Egrandis_v1_0.007021m)
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrDiOx01
start..stop
S start..stop
EcamDiOx01 1306 0 1..632 1..632
EglDiOx01 1294 0 1..628 1..629
EguDiOx01 1291 0 1..632 1..632
PtDiOx02 1090 0 1..632 1..632
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29824025..29824117 93 N° 2 29824213..29824473 261 N° 3 29825420..29825569 150 N° 4 29825758..29825891 134
N° 5 29826579..29826792 214 N° 6 29827211..29827356 146 N° 7 29827484..29827711 228 N° 8 29827910..29828112 203
N° 9 29828196..29828439 244 N° 10 29828559..29828784 226  
join(29824025..29824117,29824213..29824473,29825420..29825569,29825758..29825891 ,29826579..29826792,29827211..29827356,29827484..29827711,29827910..29828112,298 28196..29828439,29828559..29828784)


exon

Literature and cross-references EgrDiOx01 (Eucgr.K02262 / Egrandis_v1_0.007021m)
DNA ref. Phytozome 12:   scaffold_11 (29824025..29828784)
Protein sequence: EgrDiOx01 (Eucgr.K02262 / Egrandis_v1_0.007021m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   632
PWM (Da):   %s   72465.08  
PI (pH):   %s   8.78
Sequence 673
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALISVFSSLIHPQLRPMVSKMSLFDALIFLVIHAVDKLGLWHRLPVYMGLAYVGMRRHLHQRYNLIHVGSVDGKKYDTQAFNYRTADGRCNHPSDDVVGSRGTLFGRNMPPSTSTYGLMDPHPSVVASKLLARKEFIDNGKQFNMIACSWIQFMIHDWVDHMEETDQVEIEAPDEVAEKCPLKSFRFNKTKKVSTGSSHLKNGSLNIRTPWWDGSVIYGNDDNGERRVRTFKDGKLKISGDGLLEHDEKGIPISGDVRNSWAGFSLLQALFVKEHNTVCDMLKKYYPDLDDEKLYRHARLVTSAVIAKIHTIDWTVELLKTDTLLAGMRINWYGFLGKKFKDMFGHICGPILSGLVGLKRPRDHGVPYSLSEEFVSVYRMHSLLPDKLILRDVNSTILEHKCLPVAEEIPMREVVGRQGQRRLSKIGMEQMMVSLGHQACGALSLWNYPSWMRNLVPQDVDGKDRPDSIDMAALEIYRDRERGIARYNEFRRNVLMIPISRWEDLTDDKRVIRALREVYGDDVEKLDLLVGLHAEKKIKGFAISETAFFIFLLIASRRLEADRFFTTNFNTQTYTEKGLEWVNRTETLKDVIDRHFPDMTRKYMRCSSAFAVWDSQPTPTSHIPLYLRHAP

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns). Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTTGATCTCTGTTTTCTCTTCCCTCATCCATCCTCAGCTTCGCCCTATGGTCTCCAAAATGAGCCTCTTCGACGCGCTAATCTTCCTCGTACGTAACTCCCTCTCCCACAAAAAGA
TGAGAGATGTGGTCGACGAGTGATCTGGCTTTTGATTTCTTACTGTTGTTTTGGGTGTTTCATGTAGGTGATACATGCGGTGGACAAGCTAGGATTATGGCACAGACTGCCGGTGTACAT
GGGGCTTGCCTACGTGGGGATGAGAAGGCACTTGCACCAGAGATATAATCTCATACACGTTGGTAGTGTTGACGGCAAGAAGTATGATACTCAGGCATTCAACTATCGGACGGCGGACGG
AAGGTGCAACCACCCGAGCGACGATGTCGTGGGTAGTCGAGGAACATTATTTGGACGCAACATGCCTCCCTCCACTTCAACCTACGGG
GTAAGCATGTATTATAGGTCTTCTGATTTACT
CAGTTTATCAAATCAGAGAGGTTGAGTTTACGTTTATCTGTTTCTTCTTCTTAAAATCAGAAGTTTATATTACTTTAAAAAGAGCAGGCAACTGATAAAACTGTCCTTAATGCTCATTTG
CGACGGCTTACTAGGCGTCGCCTGTGTCACCCGTATACTTTCTTAATTGGAGCTACTGACGGTCCAGCGAGCCGGTTGACACCAGTGACTGCTATCGGAGCCATCCCTAAAAGCCGCATT
AGGGGCAGTTTTCCTGTCCCTAAACTCGCTTGAGAATAATATCCATAAAAGAGCTACTTTTTTTCTGTCATTTCCCGGTGGGGAGAGCAAAAACGTGCAAAGCTTTGATCATAGAAAGAC
ACCAATTCGATGACAATTATTCTCTCTAGTGCAGGAAGATTTATTAAAATTTCAAGTTAAAGGATGAAATTTTTCTTTTTTTATTGAAAAAAACTAAAGTAAATTTTCTATCATATCGGA
GAAGATGAAAATGCAACTTCAGAAAGTTACCCAACCACAAGCCATTAAAGAATTCCAGCAGTCTCTACTTTAGGTTTCTATCAATGGCCCACAGTCAAAATCTACATATGGACTGCCATG
GCTGGTCAGAAAAAAAATTCCACTTCCCAAGGGCCTCATTCTCTTCATTTGGTTTACCATTAATTTACTCAACTCATTAAGTGGGAGGCAGGCTATGGCCCTGTCACACCGCCCATGTCC
ACGGATTAGATTTGTTCAGTTTCTGTCTGAAATGGCCTACAAATTTCATGAACTTGATTCTATCTCCGCTTGGACAACAGCTGTCCAGTCTTATCTGTCAATCGTAAAGATTATTGTCTT
CTGATCGAATACCAAGTACAAGCATAGCCTGCAATACCAACAAAACTAATTTTGATTGTCTTCTTTTTCCACAGTTAATGGATCCACATCCATCTGTGGTGGCATCCAAGCTTTTGGCAA
GAAAAGAGTTCATTGACAATGGGAAGCAATTCAACATGATAGCATGCTCATGGATACAGTTCATGATTCATGACTGGGTTGATCACATGGAGGAAACTGATCAG
GTACTAGATACAACAA
AAAAAAAGAAAAAGTCCCCATAGCCTCTGTATTACACAAGGCACAGCTTGATATTTTGTAGGAAAACAACCTCAGAATATTTTTGACAAACTCAAAATGGAGAAGTAGCCGAATGGATCC
ACCAGTTGGGTCATCGCATTGAAGACTGAATGATCAATAATATCTTCGGCAGGTTGAAATTGAAGCACCTGATGAAGTTGCAGAGAAGTGTCCATTGAAGTCATTCCGATTTAACAAGAC
CAAGAAAGTGTCAACTGGGTCATCTCATTTGAAGAATGGCTCTTTGAATATAAGGACCCCGTGGTG
GTAAGTTCCTGCGAACAGTATTGTAATTACTCAGGACTACTAAACTTTAGGCAG
CCATTCAAAAAACTCATGTCACTGAAAACAAGTCTTTGCAGCCATCTGATTCATGATCCTTTTACGAGTTGAATGCAGAAAAAGATGGTGAAGAAAGATTTGGAAAAAAGATTAAGAAGC
AATGTTGTAGACAATATTTCAACCTCGCTGAGCCATAAGACTTGGAATTCCCTGCTTTTTGCCTTCACCACCTGAACAAACAGAGAACTATGAACTTTCGTTATGCTGTCACCAGACAGA
TGTCCATATTTGTTCTCAGTTTGTTCTTAGATGCTGGAGAGTTCCTCAATAAAATGGAATGTGGCCTGGGTAGAATAGTACTCCGAGGAAACTATGGAAACTACATACAGATATTCCAAA
ATTTCGTTTATATGCGCTAAAATTTGCTTACATGTAGGGTTTCATCTAAAATTGATGTCACTATGAAGTCTAGTACTTCCAGTAAGGCAACTAAGCCAATGACTTAAGGTGTGATTTCAT
CTCAAAAGAAAAAAAGGTGGCTATCTGAGTAATGATTAGCTGATCTTAGTCAAAACCTCACCAGTTAACTTGTTACTGCTCTAAGAGTTTTCTCGAAGAATTGACATGAAGATGTGAATT
TCATCAATGAGTTGTACATTGTAAACTGCTTAGGGATGGAAGCGTGATATATGGAAATGACGATAATGGCGAGAGAAGAGTGAGGACCTTCAAAGATGGGAAGCTAAAGATTTCGGGAGA
TGGCCTCCTCGAACACGACGAGAAAGGGATTCCTATTTCAGGCGACGTCAGGAATAGCTGGGCTGGCTTTTCACTCTTGCAGGCCTTATTCGTCAAAGAACACAACACTGTCTGCGATAT
GCTTAAA
GTAAGGCCTCCCTTCTCTTCCACCAATCCAATGAAAAGAACTTCCTTATTAAACAATGCTGATCCCTAGTTTTCGATCGAGATCTGGTGAAATGTCCATGAACTCCTGATATT
GTTGTTTCCAAATTCTTCAAGTCTATAAGGGCCGACACTTCTCTCGTCATTGTTATTTGCTTGGACGAAAAGTTAGCTCTGAATACAACTGCACATCTTTTACCTGAGGAACTATTATAG
AACAAAGAAGCCTGACATCTTTGATCATCGTCAGAACCATATCTCATATAATTACCCTGGCTTCATGCGTGCTATCCTTAGGGTTGAGCGGTATCAACATAACATTTCATTGAAAAAATT
GCCGGCACTCATATACCAAAGAAACTACAAGGATAGCTAATATTATGTACTTGTATGTGTGTCAGAAATATTATCCAGATCTTGATGACGAGAAGCTCTATCGCCATGCCAGATTGGTAA
CTTCAGCTGTAATTGCCAAAATCCACACTATTGACTGGACTGTGGAGCTCCTGAAGACTGACACTCTTCTTGCTGGAATGAGGATAAACTG
GTAATAAAGAGAGAAAAATGGATCTGATG
ATGAACGACTGGGGATTTACTAGTAGTAGTTCTAAAACTAACGCATAATTCTGTGATAATGCTGTACTTACTACTTACCACTATCATGCCTGGTTCAGGTACGGATTTCTGGGGAAGAAA
TTTAAGGATATGTTCGGACATATATGCGGTCCGATATTGAGTGGATTAGTAGGTCTCAAAAGGCCGAGAGATCATGGAGTTCCATACTCACTCTCTGAGGAGTTTGTCAGCGTCTATAGG
ATGCATTCACTCCTCCCGGATAAACTCATCCTGAGGGACGTCAACTCAACTATCCTGGAACACAAATGTCTGCCCGTTGCAGAAGA
GTAAGCATCTTACCATACCATTTGCATCTAATTT
CACTTTCTTCATGTTTGCTGTTACTGCCAAACTAAGGTCGCACTGACAAAAGCAAAGAACTTCGATCTCATGAAATAACAGATATATTGTCTTCTTCGGGAAATGGCTTTCAATTTTACT
TCTAGAGGGACTACAGTCACTAATTGTTCTAGGAAAATTACTAGGATTCCGATGCGGGAAGTGGTGGGACGACAAGGGCAGAGAAGACTCTCGAAGATTGGAATGGAGCAGATGATGGTG
TCACTAGGTCATCAGGCATGTGGGGCTCTCTCATTGTGGAATTATCCATCTTGGATGAGAAACCTTGTTCCTCAAGATGTCGATGGCAAAGATAGACCCGACTCAATCGACATGGCAGCT
TTAGAAA
GTAACATGACTACTCACCTCATTTCTTTCGCACTGCTATATCAACGTGACTGCACTCGAACTGACGCTCGCATATTGGGCCAGTTTACAGAGACAGGGAGAGAGGTATCGCAC
GGTACAACGAGTTCAGAAGAAACGTGCTGATGATCCCAATCAGCCGCTGGGAAGATTTGACTGATGATAAGCGAGTTATTCGAGCCTTGCGAGAAGTCTATGGAGACGATGTGGAGAAGC
TTGACCTGTTGGTGGGTTTGCATGCAGAGAAGAAGATCAAGGGCTTTGCCATAAGCGAAACTGCTTTCTTCATCTTTCTACTGATTGCATCCAG
GTACCTCTCATATCCCCAACCCAATT
AGGATACCCTGGAAGTGTTGACCCTTAATTCCATAACGTCCTGGCTGTGCCTTCTAACTTCTTGAACCCTCGTTCTTGATAATTTTTTTCCAGGCGGCTAGAAGCCGACCGGTTCTTTAC
AACCAACTTCAACACACAGACATACACAGAGAAAGGCCTGGAATGGGTAAACAGGACGGAGACATTGAAGGACGTCATAGATCGTCACTTCCCCGATATGACGAGGAAGTATATGAGATG
TTCAAGCGCATTCGCTGTATGGGATTCACAGCCAACGCCAACCTCACACATACCCCTCTATTTGCGTCATGCGCCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTTGATCTCTGTTTTCTCTTCCCTCATCCATCCTCAGCTTCGCCCTATGGTCTCCAAAATGAGCCTCTTCGACGCGCTAATCTTCCTCGTGATACATGCGGTGGACAAGCTAGGAT
TATGGCACAGACTGCCGGTGTACATGGGGCTTGCCTACGTGGGGATGAGAAGGCACTTGCACCAGAGATATAATCTCATACACGTTGGTAGTGTTGACGGCAAGAAGTATGATACTCAGG
CATTCAACTATCGGACGGCGGACGGAAGGTGCAACCACCCGAGCGACGATGTCGTGGGTAGTCGAGGAACATTATTTGGACGCAACATGCCTCCCTCCACTTCAACCTACGGG
TTAATGG
ATCCACATCCATCTGTGGTGGCATCCAAGCTTTTGGCAAGAAAAGAGTTCATTGACAATGGGAAGCAATTCAACATGATAGCATGCTCATGGATACAGTTCATGATTCATGACTGGGTTG
ATCACATGGAGGAAACTGATCAG
GTTGAAATTGAAGCACCTGATGAAGTTGCAGAGAAGTGTCCATTGAAGTCATTCCGATTTAACAAGACCAAGAAAGTGTCAACTGGGTCATCTCATT
TGAAGAATGGCTCTTTGAATATAAGGACCCCGTGGTG
GGATGGAAGCGTGATATATGGAAATGACGATAATGGCGAGAGAAGAGTGAGGACCTTCAAAGATGGGAAGCTAAAGATTTCGG
GAGATGGCCTCCTCGAACACGACGAGAAAGGGATTCCTATTTCAGGCGACGTCAGGAATAGCTGGGCTGGCTTTTCACTCTTGCAGGCCTTATTCGTCAAAGAACACAACACTGTCTGCG
ATATGCTTAAA
AAATATTATCCAGATCTTGATGACGAGAAGCTCTATCGCCATGCCAGATTGGTAACTTCAGCTGTAATTGCCAAAATCCACACTATTGACTGGACTGTGGAGCTCCTGA
AGACTGACACTCTTCTTGCTGGAATGAGGATAAACTG
GTACGGATTTCTGGGGAAGAAATTTAAGGATATGTTCGGACATATATGCGGTCCGATATTGAGTGGATTAGTAGGTCTCAAAA
GGCCGAGAGATCATGGAGTTCCATACTCACTCTCTGAGGAGTTTGTCAGCGTCTATAGGATGCATTCACTCCTCCCGGATAAACTCATCCTGAGGGACGTCAACTCAACTATCCTGGAAC
ACAAATGTCTGCCCGTTGCAGAAGA
GATTCCGATGCGGGAAGTGGTGGGACGACAAGGGCAGAGAAGACTCTCGAAGATTGGAATGGAGCAGATGATGGTGTCACTAGGTCATCAGGCAT
GTGGGGCTCTCTCATTGTGGAATTATCCATCTTGGATGAGAAACCTTGTTCCTCAAGATGTCGATGGCAAAGATAGACCCGACTCAATCGACATGGCAGCTTTAGAAA
TTTACAGAGACA
GGGAGAGAGGTATCGCACGGTACAACGAGTTCAGAAGAAACGTGCTGATGATCCCAATCAGCCGCTGGGAAGATTTGACTGATGATAAGCGAGTTATTCGAGCCTTGCGAGAAGTCTATG
GAGACGATGTGGAGAAGCTTGACCTGTTGGTGGGTTTGCATGCAGAGAAGAAGATCAAGGGCTTTGCCATAAGCGAAACTGCTTTCTTCATCTTTCTACTGATTGCATCCAG
GCGGCTAG
AAGCCGACCGGTTCTTTACAACCAACTTCAACACACAGACATACACAGAGAAAGGCCTGGAATGGGTAAACAGGACGGAGACATTGAAGGACGTCATAGATCGTCACTTCCCCGATATGA
CGAGGAAGTATATGAGATGTTCAAGCGCATTCGCTGTATGGGATTCACAGCCAACGCCAACCTCACACATACCCCTCTATTTGCGTCATGCGCCTTAA

Retrieve as FASTA